DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and LOC101882789

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_021331508.1 Gene:LOC101882789 / 101882789 -ID:- Length:181 Species:Danio rerio


Alignment Length:170 Identity:47/170 - (27%)
Similarity:77/170 - (45%) Gaps:41/170 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVC 174
            :|..|:..|.:::            |.||||:::|||:.||..|.:||.|..:.|.....|....
Zfish     2 LVKELIFDCWMSI------------CAGIASMTVPVYIAETSPPHLRGRLVTINTLFITAGQFTA 54

  Fly   175 YV---AGSFM---NW----------SMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKA 223
            .|   |.|:|   .|          ::|.|||      ||.|    ||:|||.:.:|..::||:.
Zfish    55 SVIDGAFSYMKHEGWRYMLGLSVIPALLQFLG------FLFL----PESPRWLIQKGLTQKARRV 109

  Fly   224 LKWLRGKEADVEPELKELMQS--QADADRQATQNTCLELF 261
            |..:||.: :::.|...:..|  :.:.|....:...|.:|
Zfish   110 LSQIRGNQ-NIDEEYDTIKSSIEEEEKDCGGGEKKVLHVF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 47/170 (28%)
MFS 33..454 CDD:119392 47/170 (28%)
LOC101882789XP_021331508.1 Sugar_tr <14..>135 CDD:331684 41/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.