DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tox and Dsp1

DIOPT Version :9

Sequence 1:NP_001102124.1 Gene:Tox / 362481 RGDID:1310455 Length:525 Species:Rattus norvegicus
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:330 Identity:75/330 - (22%)
Similarity:116/330 - (35%) Gaps:88/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Rat   118 ITVSNMLGQDGTLLSNSISVMQEIGNAEGAQ--YSSHPQ-------LAAMRPRGQPTDLRQQASM 173
            :..||..|..|.....:::.........|:|  ||:..|       .|.::.:.|....:||...
  Fly    85 VATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQ 149

  Rat   174 MQHGQLTTINQSQLSAQLGLNMGGTNVPHNSPSPPGSKSATPSPSSSV----------------- 221
            .||.|...:.|.|....:          .||.||.....|...|...:                 
  Fly   150 QQHQQQQQMQQQQQQQNV----------INSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKK 204

  Rat   222 HEDE----------CEDTSK-INGGEKRPASDMGKKPK-----------TPK-------KKKK-- 255
            |.||          |.:..| :...||:...:|.:|.|           .||       ||:|  
  Fly   205 HPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQI 269

  Rat   256 KDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKE 320
            ||||.|::.:||:..|..|.:..:|..||....|:::|.:...|..:..|.||.|:...|..|..
  Fly   270 KDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKAR 334

  Rat   321 YLKQLAAYRASLVSKSYNDPVDVKTSQPPQLVNSKPSVFHG-PSQAHSALYLSSHYHQQPGMTPQ 384
            |.:::..|:.|                 .::..|.||:... .:||..|..|::...||   ..|
  Fly   335 YEREMTEYKTS-----------------GKIAMSAPSMQASMQAQAQKAALLAAAAQQQ---HQQ 379

  Rat   385 LTAMH 389
            |...|
  Fly   380 LEEQH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ToxNP_001102124.1 NHP6B <257..>360 CDD:227935 26/102 (25%)
HMG-box 261..>310 CDD:238037 14/48 (29%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 11/69 (16%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.