DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-1 and ATR1

DIOPT Version :9

Sequence 1:NP_610693.1 Gene:Tret1-1 / 36248 FlyBaseID:FBgn0050035 Length:857 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:561 Identity:107/561 - (19%)
Similarity:186/561 - (33%) Gaps:179/561 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 SRQHFQQQRSISTDSRKSRRLYEMDEMDNKRGENIRHAVPFVRQITE--DGKPKLEVYRPTTNPI 391
            |:..::.:..:..  :||.|       ||..||::. |..|.:...|  |...|.:      ||.
Yeast    12 SKGEYENETELPV--KKSSR-------DNNIGESLT-ATAFTQSEDEMVDSNQKWQ------NPN 60

  Fly   392 YI---WTQVLAALSVSLGSLVVGFVSAYTSPALVSMTDRNITSFEVTQDAGSWVGGIMPLAGLAG 453
            |.   |.:.|...:..:..|:....:..|...:..::|    ||....::.||:....||...:.
Yeast    61 YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSD----SFGSEGNSKSWLMASFPLVSGSF 121

  Fly   454 GIAGGPLIEYLGRRNTILATAVPFIVSSLLIACAV-----NVAMVLCGRFLAGFCVGIASLSLPV 513
            .:..|.|.:..|.:..:|...|..|:.||:  |.:     :....:..|...|  :|||      
Yeast   122 ILISGRLGDIYGLKKMLLVGYVLVIIWSLI--CGITKYSGSDTFFIISRAFQG--LGIA------ 176

  Fly   514 YLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGSFMNWSMLAFLGAALP---------------- 562
                .|.|.|.|.:       |||     :|.|:|....:::|:||..|                
Yeast   177 ----FVLPNVLGII-------GNI-----YVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE 225

  Fly   563 -----------------VPFLILMFLIPETPRWFVGRGLEERARKALKWLRGKEADVEPELKGLM 610
                             :.|::.::.||.|    :...:.   ..::.|:......:...|...:
Yeast   226 DPKQWPWAFYAYSIAAFINFVLSIYAIPST----IPTNIH---HFSMDWIGSVLGVIGLILLNFV 283

  Fly   611 RSQADAD--RQA-----------------------SRNTMLELLKLNNLKPLSISLGLMFFQQFS 650
            .:||...  .||                       ::..:|....:.:...:.|.|.|.|.....
Yeast   284 WNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSF 348

  Fly   651 GINAVIFYTVQI-FKD-----AGST-----IDGNLCTIIVGIVNFLATFIGIVLIDRAGRKILLY 704
            ||....::..|: .:.     ||.|     |.|.:..::||..           |......:.|:
Yeast   349 GIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFT-----------IKNVSPSVFLF 402

  Fly   705 VSDIAMVLTLFVLGGFF---------YCKTYGPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMM 760
            .|.:|     |.:|...         |.:|      .||.:     :|...|..|.| |...::.
Yeast   403 FSMVA-----FNVGSIMASVTPVHETYFRT------QLGTM-----IILSFGMDLSF-PASSIIF 450

  Fly   761 GEILPAKIRGSAAS-VATAFNWFCTFVVTKTFQDLTVAMGA 800
            .:.||.:.:|.|.| |.|..|:         ...|.:.|||
Yeast   451 SDNLPMEYQGMAGSLVNTVVNY---------SMSLCLGMGA 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-1NP_610693.1 SP 382..833 CDD:273317 94/506 (19%)
MFS 401..822 CDD:119392 89/484 (18%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 89/484 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.