DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-1 and STP2

DIOPT Version :9

Sequence 1:NP_610693.1 Gene:Tret1-1 / 36248 FlyBaseID:FBgn0050035 Length:857 Species:Drosophila melanogaster
Sequence 2:NP_172214.5 Gene:STP2 / 837245 AraportID:AT1G07340 Length:498 Species:Arabidopsis thaliana


Alignment Length:405 Identity:126/405 - (31%)
Similarity:209/405 - (51%) Gaps:26/405 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 LAGLAGGIAGGPLIEYLGRRNTILATAVPFIVSSLLIACAVNVAMVLCGRFLAGFCVGIASLSLP 512
            |||:........:....||:.||:..::.|:|.::|...|..:.|::.||.|.||.:|..:.::|
plant    90 LAGIFASFISSYVSRAFGRKPTIMLASIFFLVGAILNLSAQELGMLIGGRILLGFGIGFGNQTVP 154

  Fly   513 VYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGSFMNW--SML------AFLGAALPVPFLIL- 568
            :::.|......||.|.::......||||    |.|::|:  |.|      :..|||:|...|:: 
plant   155 LFISEIAPARYRGGLNVMFQFLITIGIL----AASYVNYLTSTLKNGWRYSLGGAAVPALILLIG 215

  Fly   569 MFLIPETPRWFVGRGLEERARKALKWLRGKEADVEPELKGLMRSQADADRQASRNTMLELL-KLN 632
            .|.|.|||...:.||.:|:.::.|:.:||.| |:|.|...:..:...|.:  .::...||. |..
plant   216 SFFIHETPASLIERGKDEKGKQVLRKIRGIE-DIELEFNEIKYATEVATK--VKSPFKELFTKSE 277

  Fly   633 NLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDGNL-CTIIVGIVNFLATFIGIVLIDR 696
            |..||.....|.|||||:|||.|:||...:|:..||..:.:| .|::...||.:||.|.::::|.
plant   278 NRPPLVCGTLLQFFQQFTGINVVMFYAPVLFQTMGSGDNASLISTVVTNGVNAIATVISLLVVDF 342

  Fly   697 AGRKILLYVSDIAMVLTLFVLGGFF--YCKTYGPDVSHLGWLPLTCFV---IYILGFSLGFGPIP 756
            |||:.||....:.|..|...:||..  :.|..||...|.  :||...:   :|:.||:..:||:.
plant   343 AGRRCLLMEGALQMTATQMTIGGILLAHLKLVGPITGHA--VPLIVLILICVYVSGFAWSWGPLG 405

  Fly   757 WLMMGEILPAKIRGSAASVATAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGLFFVIIY 821
            ||:..||.|.::|.:....|.|.|..|||::.:.|........:. .|:.||.:..:...||:.:
plant   406 WLVPSEIYPLEVRNAGYFCAVAMNMVCTFIIGQFFLSALCRFRSL-LFFFFGIMNIIMGLFVVFF 469

  Fly   822 VPETQGKTLEDIERK 836
            :|||:|..:|::..|
plant   470 LPETKGVPIEEMAEK 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-1NP_610693.1 SP 382..833 CDD:273317 125/400 (31%)
MFS 401..822 CDD:119392 120/389 (31%)
STP2NP_172214.5 MFS_STP 29..472 CDD:340919 120/391 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.