DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and RBX1

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_055063.1 Gene:RBX1 / 9978 HGNCID:9928 Length:108 Species:Homo sapiens


Alignment Length:106 Identity:52/106 - (49%)
Similarity:67/106 - (63%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDRP--TDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQ 71
            ||.|  |:.| |||  |.|.:|||||||:|:||:..|.|||||..:||.|:.|||:.....  .:
Human     7 VDTPSGTNSG-AGK--KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT--SE 66

  Fly    72 DCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMG 112
            :|.|.||.|||:||..|:|.|:|....|||..:||..|:.|
Human    67 ECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 43/88 (49%)
zf-rbx1 25..103 CDD:289448 39/77 (51%)
RBX1NP_055063.1 mRING-H2-C3H2C2D_RBX1 40..101 CDD:319399 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.