DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and APC11

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_010276.3 Gene:APC11 / 851554 SGDID:S000002166 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:26/101 - (25%)
Similarity:42/101 - (41%) Gaps:28/101 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NAVAMWSW------------------DVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVW 77
            ::|..|||                  |.:.|:|.|||.....:|..|:...       ..|.:|.
Yeast     9 HSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-------DQCPLVI 66

  Fly    78 GECNHSFHHCCMSLWV---KQNNRCPLCQQEWSIQR 110
            |.|:|:||..|:..|:   .....||:|:|.:.:|:
Yeast    67 GLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 26/101 (26%)
zf-rbx1 25..103 CDD:289448 23/92 (25%)
APC11NP_010276.3 zf-ANAPC11 1..102 CDD:403920 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.