powered by:
Protein Alignment Roc2 and AT5G26640
DIOPT Version :9
Sequence 1: | NP_001163119.1 |
Gene: | Roc2 / 36246 |
FlyBaseID: | FBgn0044020 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_850881.1 |
Gene: | AT5G26640 / 832725 |
AraportID: | AT5G26640 |
Length: | 62 |
Species: | Arabidopsis thaliana |
Alignment Length: | 41 |
Identity: | 11/41 - (26%) |
Similarity: | 19/41 - (46%) |
Gaps: | 7/41 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 VAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDC 73
:|..:||.:.:.|.:||:....||..|: :...||
plant 1 MAWGTWDAQDETCGLCRMPFDASCPDCK-------LPEDDC 34
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5194 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1587140at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.