DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and AT5G26640

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_850881.1 Gene:AT5G26640 / 832725 AraportID:AT5G26640 Length:62 Species:Arabidopsis thaliana


Alignment Length:41 Identity:11/41 - (26%)
Similarity:19/41 - (46%) Gaps:7/41 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDC 73
            :|..:||.:.:.|.:||:....||..|:       :...||
plant     1 MAWGTWDAQDETCGLCRMPFDASCPDCK-------LPEDDC 34

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 11/41 (27%)
zf-rbx1 25..103 CDD:289448 11/41 (27%)
AT5G26640NP_850881.1 RING_Ubox 10..>36 CDD:388418 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.