DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and RBX1

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001154725.1 Gene:RBX1 / 832179 AraportID:AT5G20570 Length:142 Species:Arabidopsis thaliana


Alignment Length:119 Identity:44/119 - (36%)
Similarity:59/119 - (49%) Gaps:26/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVW----- 77
            :.|..|.|.:|||:|||:|:||:..|.|||||..:||.|:.|||:.....  .::|.|.|     
plant    25 SNKKAKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT--SEECTVAWEDDQN 87

  Fly    78 -------------------GECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMG 112
                               |.|||:||..|:|.|:|....|||...||..|:.|
plant    88 NCNKYFCILDCSMKDDHLEGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 42/112 (38%)
zf-rbx1 25..103 CDD:289448 38/101 (38%)
RBX1NP_001154725.1 RING 30..142 CDD:302633 43/114 (38%)
zf-rbx1 31..132 CDD:289448 38/102 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11210
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.