DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and AT3G42830

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_189869.1 Gene:AT3G42830 / 823327 AraportID:AT3G42830 Length:115 Species:Arabidopsis thaliana


Alignment Length:106 Identity:46/106 - (43%)
Similarity:63/106 - (59%) Gaps:5/106 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQ 71
            :|:..|:   .:.|..|.|.||||:|||:|:||:..|.|||||..:||.|:.|.|:.....  .:
plant    14 SSISVPS---SSSKNSKRFELKKWSAVALWAWDIVVDNCAICRNHIMDLCIECLANQASAT--SE 73

  Fly    72 DCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMG 112
            :|.|.||.|||:||..|:|.|:|....|||...||..|:.|
plant    74 ECTVAWGVCNHAFHFHCISRWLKTRQVCPLDVCEWEFQKYG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 42/88 (48%)
zf-rbx1 25..103 CDD:289448 38/77 (49%)
AT3G42830NP_189869.1 mRING-H2-C3H2C2D_RBX1 47..108 CDD:319399 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11210
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.