DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and APC11

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001325493.1 Gene:APC11 / 819756 AraportID:AT3G05870 Length:90 Species:Arabidopsis thaliana


Alignment Length:84 Identity:30/84 - (35%)
Similarity:46/84 - (54%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWV 93
            :|:|||.|:||.:.:.|.|||:.....|..|:       :...||.::||.|||:||..|:..||
plant    13 EWHAVASWTWDAQDETCGICRMAFDGCCPDCK-------LPGDDCPLIWGACNHAFHLHCILKWV 70

  Fly    94 KQNN---RCPLCQQEWSIQ 109
            ....   .||:|::||..:
plant    71 NSQTSQAHCPMCRREWQFK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 30/84 (36%)
zf-rbx1 25..103 CDD:289448 27/76 (36%)
APC11NP_001325493.1 RING-H2_APC11 26..88 CDD:319370 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.