DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and anapc11

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001091950.1 Gene:anapc11 / 768140 ZFINID:ZDB-GENE-061013-383 Length:88 Species:Danio rerio


Alignment Length:86 Identity:30/86 - (34%)
Similarity:43/86 - (50%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSL 91
            :|:||.||.|.|....:.|.|||......|..|:...       .||.:|||:|:|.||..|:..
Zfish     5 IKQWNGVASWLWVANDENCGICRASFNGCCPDCKVPG-------DDCPLVWGQCSHCFHMHCILK 62

  Fly    92 WVKQ---NNRCPLCQQEWSIQ 109
            |:..   ..:||:|:|||..:
Zfish    63 WLNSQQVQQQCPMCRQEWKFK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 30/86 (35%)
zf-rbx1 25..103 CDD:289448 26/78 (33%)
anapc11NP_001091950.1 RING 1..84 CDD:302633 30/86 (35%)
zf-rbx1 2..77 CDD:289448 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.