DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and lmgA

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster


Alignment Length:84 Identity:30/84 - (35%)
Similarity:42/84 - (50%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMS 90
            |:|.|..||.|.|....:.|.|||:....:|..|       .:...||.:|||.|:|.||..|:.
  Fly     4 TIKSWTGVATWRWIANDENCGICRMSFESTCPEC-------ALPGDDCPLVWGVCSHCFHMHCIV 61

  Fly    91 LWVK---QNNRCPLCQQEW 106
            .|:.   .|.:||:|:|.|
  Fly    62 KWLNLQPLNKQCPMCRQSW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 30/84 (36%)
zf-rbx1 25..103 CDD:289448 27/79 (34%)
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.