DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and ANAPC11

DIOPT Version :10

Sequence 1:NP_610691.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001002244.1 Gene:ANAPC11 / 51529 HGNCID:14452 Length:196 Species:Homo sapiens


Alignment Length:33 Identity:13/33 - (39%)
Similarity:16/33 - (48%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKKWNAVAMWSWDVECDICAICRVQVMDSCLRC 59
            :|.||.||.|.|....:.|.|||:.....|..|
Human     5 IKCWNGVATWLWVANDENCGICRMAFNGCCPDC 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_610691.1 RING-H2_RBX2 42..106 CDD:438129 6/18 (33%)
ANAPC11NP_001002244.1 RING_Ubox 1..>51 CDD:473075 13/33 (39%)

Return to query results.
Submit another query.