DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and Anapc11

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001119554.1 Gene:Anapc11 / 498030 RGDID:1561880 Length:84 Species:Rattus norvegicus


Alignment Length:86 Identity:30/86 - (34%)
Similarity:43/86 - (50%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSL 91
            :|.||.||.|.|....:.|.|||:.....|..|:...       .||.:|||:|:|.||..|:..
  Rat     5 IKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPG-------DDCPLVWGQCSHCFHMHCILK 62

  Fly    92 WV---KQNNRCPLCQQEWSIQ 109
            |:   :....||:|:|||..:
  Rat    63 WLNAQQVQQHCPMCRQEWKFK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 30/86 (35%)
zf-rbx1 25..103 CDD:289448 26/78 (33%)
Anapc11NP_001119554.1 RING_Ubox 1..84 CDD:418438 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.