DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and Roc1a

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster


Alignment Length:104 Identity:45/104 - (43%)
Similarity:62/104 - (59%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDC 73
            |:..||...:..|.:.   |:|||||:|:||:..|.|||||..:||.|:.|||:.....  .::|
  Fly    37 VNECTDGNTSSFPLRR---KQWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT--SEEC 96

  Fly    74 VVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMG 112
            .|.||.|||:||..|:|.|:|....|||..:||..|:.|
  Fly    97 TVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 40/88 (45%)
zf-rbx1 25..103 CDD:289448 37/77 (48%)
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 41/85 (48%)
zf-rbx1 53..126 CDD:289448 37/74 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463168
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.