DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and Rbx1

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001029307.1 Gene:Rbx1 / 300084 RGDID:1308453 Length:108 Species:Rattus norvegicus


Alignment Length:106 Identity:52/106 - (49%)
Similarity:67/106 - (63%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDRP--TDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQ 71
            ||.|  |:.| |||  |.|.:|||||||:|:||:..|.|||||..:||.|:.|||:.....  .:
  Rat     7 VDTPSGTNSG-AGK--KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT--SE 66

  Fly    72 DCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMG 112
            :|.|.||.|||:||..|:|.|:|....|||..:||..|:.|
  Rat    67 ECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 43/88 (49%)
zf-rbx1 25..103 CDD:289448 39/77 (51%)
Rbx1NP_001029307.1 mRING-H2-C3H2C2D_RBX1 40..101 CDD:319399 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.