DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and rbx1

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_593388.1 Gene:rbx1 / 2541897 PomBaseID:SPAC23H4.18c Length:107 Species:Schizosaccharomyces pombe


Alignment Length:93 Identity:48/93 - (51%)
Similarity:60/93 - (64%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSF 84
            ||.: |.:|||||||:|.||:..|.|||||..:||.|:.|||:.  |....|:|.|.||.|||:|
pombe    17 KPPR-FEIKKWNAVALWQWDIVVDNCAICRNHIMDLCIECQANT--DSAAAQECTVAWGTCNHAF 78

  Fly    85 HHCCMSLWVKQNNRCPLCQQEWSIQRMG 112
            |..|:|.|:...|.|||..:||..||.|
pombe    79 HFHCISRWLNTRNVCPLDNREWEFQRYG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 45/88 (51%)
zf-rbx1 25..103 CDD:289448 41/77 (53%)
rbx1NP_593388.1 APC11 19..107 CDD:227521 46/91 (51%)
zf-rbx1 20..97 CDD:289448 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54028
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.