DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and rbx-2

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_491849.1 Gene:rbx-2 / 172344 WormBaseID:WBGene00019993 Length:112 Species:Caenorhabditis elegans


Alignment Length:115 Identity:61/115 - (53%)
Similarity:79/115 - (68%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADDPENSVD---RPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADN 63
            ||..|.|..   :.|.:....:|   |.||||||:|:|:||||||.||||||.:|:.|||||::.
 Worm     7 ADSQEGSTSAQKQKTANPSESRP---FVLKKWNALAVWAWDVECDTCAICRVHLMEECLRCQSEP 68

  Fly    64 KRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK 113
            .      .:|.||||:||||||||||:.|::|||||||||::|.:.|..|
 Worm    69 S------AECYVVWGDCNHSFHHCCMTQWIRQNNRCPLCQKDWVVSRTSK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 54/88 (61%)
zf-rbx1 25..103 CDD:289448 50/77 (65%)
rbx-2NP_491849.1 RING-H2_RBX2 47..105 CDD:319380 39/63 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167895
Domainoid 1 1.000 98 1.000 Domainoid score I4524
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84476
Inparanoid 1 1.050 146 1.000 Inparanoid score I3021
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 1 1.000 - - FOG0006281
OrthoInspector 1 1.000 - - oto19625
orthoMCL 1 0.900 - - OOG6_108571
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 1 1.000 - - X4568
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.