DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc2 and rnf7

DIOPT Version :9

Sequence 1:NP_001163119.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001107733.2 Gene:rnf7 / 100135737 XenbaseID:XB-GENE-942277 Length:99 Species:Xenopus tropicalis


Alignment Length:100 Identity:77/100 - (77%)
Similarity:88/100 - (88%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWG 78
            :.|.:|  .|||:|||||||||||||||||.||||||||||:||||||:||     ::|||||||
 Frog     7 EHGASG--PKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENK-----QEDCVVVWG 64

  Fly    79 ECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK 113
            |||||||:||||||||||||||||||:|.:||:||
 Frog    65 ECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc2NP_001163119.1 RING 23..112 CDD:302633 73/88 (83%)
zf-rbx1 25..103 CDD:289448 65/77 (84%)
rnf7NP_001107733.2 RING-H2_RBX2 33..92 CDD:319380 52/63 (83%)
RING-H2 finger (C3H2C3-type) 36..88 CDD:319380 46/56 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5813
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84476
Inparanoid 1 1.050 178 1.000 Inparanoid score I3923
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 1 1.000 - - FOG0006281
OrthoInspector 1 1.000 - - oto102610
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4568
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.