DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33721

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:159 Identity:47/159 - (29%)
Similarity:79/159 - (49%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKFTNVKC-MDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYRP 88
            |:|||.|| :..||   ...:|||.:|.|.|....:|||.:::::||.|.:.:||..:|...|.|
  Fly    25 LEFTNFKCHVKDPT---YLSFEYCFIKSVNRTYKYISLKANMYEVPITNASAKLQISRRFRSYMP 86

  Fly    89 FMYYILFDFCKLMA-SRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEK-----FALDFTKI 147
            .......|.||.|| .:|......|...:..:|.:|.|..||: ::.:.:::     .:..||.|
  Fly    87 ITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPY-DHDLIIDRLPSKYLSEHFTNI 150

  Fly   148 SMPVPAGTYRLGFTFYAYGIARTLTQVFF 176
             :|:|.|.|.....:|:..|.|....:::
  Fly   151 -LPLPPGDYSFNSIWYSRNIERATISIYY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 24/97 (25%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.