DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33795

DIOPT Version :10

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:39/155 - (25%)
Similarity:71/155 - (45%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYRPFM 90
            |.|||.|..  .::.......|.||.|.||:...:...::.. |..::....:..:|.:||:|::
  Fly    27 KLTNVICES--RNQSWVTINECRLKAVNRNRTVFNFNATIHH-PTNDVVIDYRFLKRENGYKPWL 88

  Fly    91 YYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISMPVPAGT 155
            |....|.|:.: .:.||: ..:.|:...:..||.|.|||: ...:.:....|.....:||.|:|.
  Fly    89 YKKNIDGCRFL-RKPYDM-LTKMIYMVFKPFSNINHTCPF-YGDILIRGMYLRTEIKAMPYPSGK 150

  Fly   156 YRLGFTFYAYGIARTLTQVFFEKIE 180
            |.|...:..|...:.:|.:.::.||
  Fly   151 YMLQINWSFYKKIQVVTNISYDFIE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 23/92 (25%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 22/78 (28%)

Return to query results.
Submit another query.