powered by:
Protein Alignment CG13198 and CG33644
DIOPT Version :9
Sequence 1: | NP_610690.1 |
Gene: | CG13198 / 36245 |
FlyBaseID: | FBgn0033640 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027259.1 |
Gene: | CG33644 / 3772563 |
FlyBaseID: | FBgn0053644 |
Length: | 158 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 19/67 - (28%) |
Similarity: | 36/67 - (53%) |
Gaps: | 6/67 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 DFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALD-FTKISMPVPAGTYRLG 159
|:|:.:::....:.| :.|.|.:|:.|||...||:..| :::.:| ||.....:|:.|..:.
Fly 73 DYCQALSALQSQILF-KLIADELRRVSNFPLNCPFVMN----KRYYVDEFTINPKVIPSYTPEMI 132
Fly 160 FT 161
||
Fly 133 FT 134
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13198 | NP_610690.1 |
DM8 |
86..179 |
CDD:214778 |
19/67 (28%) |
CG33644 | NP_001027259.1 |
DUF1091 |
50..133 |
CDD:284008 |
17/64 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.