DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33723

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster


Alignment Length:157 Identity:52/157 - (33%)
Similarity:81/157 - (51%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYLLFLSVLLQDSMGTRLLKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIR 71
            |..|.|.:|:...:..| ::|||:||..:  ::...::..|.||.:.|....:|.||||.:|||.
  Fly     9 LVSLLLLMLIVKEIKPR-VEFTNLKCRSV--NKDFAEFTQCTLKSINRTYKYISTKVSLHKLPIT 70

  Fly    72 NLTTRLQCFQRRDGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMT 136
            ........::|.:|||||:|....|.|.....:..: ...::.||.|::.||.|.:||: .|.:.
  Fly    71 KARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKAN-PVAKYFFDMIKEYSNLNHSCPY-NNDII 133

  Fly   137 VEKFALD-----FTKISMPVPAGTYRL 158
            |||.:.|     .||| :|.|.|.|.|
  Fly   134 VEKVSTDTVNHHVTKI-LPYPEGDYML 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 28/78 (36%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.