DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33784

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:175 Identity:63/175 - (36%)
Similarity:88/175 - (50%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSVLLQDSMGTRLLKFTNVKCMDLPTSRGLTKYE-------YCHLKVVRRNQVELSLKVSLFQLP 69
            :::||.||  ..|.||.||||         |.||       .|.|||:.|..|.|:|...:::||
  Fly    16 INLLLSDS--NALFKFKNVKC---------TCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLP 69

  Fly    70 IRNLTTRLQCFQRRDGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENH 134
            |::.|..|..|:|..|||||::.:..|.|..:..|. ...|...::|.|:..||.|.|||:  ||
  Fly    70 IKSTTCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRK-RYPFADLVYDGIKSFSNLNHTCPF--NH 131

  Fly   135 -MTVEKFALDFTKIS-MPVPAGTYRLGFTFYAYGIARTLTQVFFE 177
             :.|.:..|:...|| .|||.|.|:|.|.....|:.|...:|..|
  Fly   132 DIIVNQMVLNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 33/94 (35%)
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472234
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.