DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33798

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:156 Identity:50/156 - (32%)
Similarity:84/156 - (53%) Gaps:8/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYRP 88
            |::.||.:|..|  .|..:.:|||.||.|.|....:||||.|||.|:..:......::|.:||:|
  Fly    20 LVEITNFECESL--DRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKVNTAIYKRLNGYKP 82

  Fly    89 FMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKEN----HMTVEKFALDFTKISM 149
            |:|.:..|.||.:.::|.: ...:|||...:..:|.|.:||:..:    .::.|......||| :
  Fly    83 FLYNVTVDGCKFIKNQNSN-PVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSAESINFQITKI-L 145

  Fly   150 PVPAGTYRLGFTFYAYGIARTLTQVF 175
            |.|.|.|.:...::||.|.|.:.:::
  Fly   146 PFPEGKYMVKMNWFAYDINRAIIRLY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 27/94 (29%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.