DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33775

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:180 Identity:55/180 - (30%)
Similarity:98/180 - (54%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYLLFLSVLLQDSMGTRL---LKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQL 68
            |.|:..::|...|:|:..   .:|.|::|.....|..:  :|.|.|.::.|.:|...:.:.|||.
  Fly     9 LILVTAAILCSLSLGSECRSKSRFINMQCESYNESYAV--FEKCKLNLLGRGRVGADMYLKLFQT 71

  Fly    69 PIRNLTTRLQCFQRRDGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKEN 133
            |:.|.......::|.:|::||:|.:..|.|:|:.:.| .:||:..:.:||:|.||.|.:||:  |
  Fly    72 PVENCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPN-AISFQGLVINAIKKGSNLNHSCPY--N 133

  Fly   134 HMTV---EKFALDFTKISMPVPAGTYRLGFTFYAYGIARTLTQVFFEKIE 180
            |..:   .:|:.||.| ::|:|.|.|::...|..|.:.|....||.|:.|
  Fly   134 HDIIVDNMEFSDDFLK-TLPLPQGVYKIQLRFATYKVWRVQVAVFIERTE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 33/95 (35%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.