DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33927

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:173 Identity:51/173 - (29%)
Similarity:83/173 - (47%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYL-LFLSVLLQ-DSMGTRLLKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLP 69
            ||| ||..:.|: .|:.....||||..| |......|..:: |.||.:||....||...::.: .
  Fly     8 LYLVLFFRIALELGSINASRFKFTNFVC-DSVNETWLAVHQ-CRLKAIRRGTTTLSFNGTVLK-T 69

  Fly    70 IRNLTTRLQCFQRRDGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKEN- 133
            |.......|.|:|.:|::|::|.|.||.|:.: .:.|:... ..:|:.::..||.|.|||:... 
  Fly    70 ISKFRVHGQIFKRANGFKPWLYNITFDGCRFL-RKPYEAPV-IIVFNLLKSFSNLNFTCPYMGPV 132

  Fly   134 -----HMTVEKFALDFTKISMPVPAGTYRLGFTFYAYGIARTL 171
                 |:..|       :|.:|:|.|.|.:...:|   |::||
  Fly   133 HIMGLHIIGE-------QIPVPLPTGEYLIQIKWY---ISKTL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 25/92 (27%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472577
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.