DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33137

DIOPT Version :10

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:138 Identity:33/138 - (23%)
Similarity:68/138 - (49%) Gaps:8/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQR--RDGYRP 88
            |..|::|..:|   |.:....||::.:..|:....:.|.|.: |:.|:|.|.|..::  .:.::|
  Fly    15 KLKNIECSTVP---GFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYSNKFQP 75

  Fly    89 FMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISMPVPA 153
            |:..::.:.|..::.|:: :.:...|....|..||||.:||:: .|:......|:.:.:....|.
  Fly    76 FLVDVVINMCDALSRRSF-IPYGLIILKIARTFSNFNHSCPYR-GHLMARGAYLNESYLPNVFPL 138

  Fly   154 GTYRLGFT 161
            |.|:...|
  Fly   139 GFYKFNIT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 18/76 (24%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 18/76 (24%)

Return to query results.
Submit another query.