DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG12898

DIOPT Version :9

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster


Alignment Length:71 Identity:17/71 - (23%)
Similarity:23/71 - (32%) Gaps:29/71 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFTNVKCMDLPTSRGLTKY---EYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYR 87
            |..|:|..|...:..|.|.   .|.||.|          ..|.|:.||                :
  Fly    65 KMENIKGCDFLNNPLLFKMFGEVYNHLVV----------NGSYFKCPI----------------K 103

  Fly    88 PFMYYI 93
            |.:||:
  Fly   104 PKVYYL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 3/8 (38%)
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.