DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13198 and CG33476

DIOPT Version :10

Sequence 1:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:43 Identity:13/43 - (30%)
Similarity:26/43 - (60%) Gaps:5/43 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RNQVELSLKVSLFQLPIR-NLTTRLQCFQRRDGYRPFMYYILF 95
            ||:..::: :.:||.|.| .:|.|::..:.||   ||:..:|:
  Fly   119 RNEGSVAM-LPVFQPPGRYQITMRVRMRESRD---PFVMEMLW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13198NP_610690.1 DM8 86..179 CDD:214778 3/10 (30%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 6/19 (32%)

Return to query results.
Submit another query.