DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and SKP2A

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001321134.1 Gene:SKP2A / 838740 AraportID:AT1G21410 Length:360 Species:Arabidopsis thaliana


Alignment Length:335 Identity:97/335 - (28%)
Similarity:172/335 - (51%) Gaps:28/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSW--QKINLFDFQRDIEGPVIENISQR 303
            |.:|.|:|:|:.|.:|..::...:.||..|.    |..|:  .::.|.....::...|:..:.:.
plant    29 KDIPVELLMRILSLVDDRNVIVASGVCTGWR----DAISFGLTRLRLSWCNNNMNSLVLSLVPKF 89

  Fly   304 CRGFLKSLSLRGCQ-SVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHS 367
            .:  |::|:||..: .:.|.:|..:|||||.::.||||...||||.|..:::..|..||.:||..
plant    90 VK
--LQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSG 152

  Fly   368 CSNITDNSLKYLSDGCPNLMEINVSWC-HLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCL 431
            |::.:|.::.||:..|..|..:|:..| ..:::|.:||:...|.:::..:...|:.|:|:.:|.|
plant   153 CTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSL 217

  Fly   432 AKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVS 496
            |..||||..|:|..|..|||.|:..||..|..|:.|.:..|.::||..:.||:|          |
plant   218 AYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYYCRNITDRAMYSLAQ----------S 272

  Fly   497 GCRNFTDIGFQALGRNCKY----LERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDG 557
            |.:|  ..|.....:..||    |..:::.:|:.:|...:..:....|:|...:..|..:::  |
plant   273 GVKN--KPGSWKSVKKGKYDEEGLRSLNISQCTALTPSAVQAVCDSFPALHTCSGRHSLVMS--G 333

  Fly   558 IRHLTTGSCA 567
            ..:|||..||
plant   334 CLNLTTVHCA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 12/45 (27%)
leucine-rich repeat 280..307 CDD:275381 2/28 (7%)
AMN1 <308..453 CDD:187754 53/146 (36%)
leucine-rich repeat 308..327 CDD:275381 6/19 (32%)
leucine-rich repeat 334..359 CDD:275381 10/24 (42%)
leucine-rich repeat 360..385 CDD:275381 9/24 (38%)
leucine-rich repeat 386..411 CDD:275381 7/25 (28%)
AMN1 <409..586 CDD:187754 47/163 (29%)
leucine-rich repeat 412..437 CDD:275381 7/24 (29%)
leucine-rich repeat 438..463 CDD:275381 11/24 (46%)
leucine-rich repeat 464..515 CDD:275381 12/50 (24%)
leucine-rich repeat 516..541 CDD:275381 3/24 (13%)
leucine-rich repeat 542..561 CDD:275381 3/18 (17%)
leucine-rich repeat 571..595 CDD:275381
leucine-rich repeat 596..621 CDD:275381
SKP2ANP_001321134.1 F-box-like 28..>63 CDD:403981 11/37 (30%)
leucine-rich repeat 66..91 CDD:275381 2/24 (8%)
leucine-rich repeat 92..118 CDD:275381 10/25 (40%)
AMN1 <115..264 CDD:187754 53/148 (36%)
leucine-rich repeat 119..144 CDD:275381 10/24 (42%)
leucine-rich repeat 145..170 CDD:275381 9/24 (38%)
leucine-rich repeat 171..197 CDD:275381 7/25 (28%)
leucine-rich repeat 198..223 CDD:275381 7/24 (29%)
leucine-rich repeat 224..249 CDD:275381 11/24 (46%)
leucine-rich repeat 250..272 CDD:275381 8/31 (26%)
leucine-rich repeat 294..313 CDD:275381 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.