DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and AT5G67140

DIOPT Version :10

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_201515.1 Gene:AT5G67140 / 836849 AraportID:AT5G67140 Length:228 Species:Arabidopsis thaliana


Alignment Length:259 Identity:57/259 - (22%)
Similarity:108/259 - (41%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LDDE-LIKQLPKEVLLRVFSY-LDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVI 297
            :|:| .|.:||.::|..:||. .....|.:.:.|||.|.         :.:|             
plant     1 MDEEAAIDRLPLDLLAYIFSLATSFTVLAQASGVCKKWR---------KAVN------------- 43

  Fly   298 ENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCK---KITDISTQSI--SRYC 357
            :::::|     ::||..|.: :.|.|...|.:...|::.||:|..:   .|||.....|  :|..
plant    44 QSMARR-----ETLSFAGWK-MDDDSTSRLVHLAFNLKELDISRSRWGCHITDNGLYQIASARCV 102

  Fly   358 SKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQ 422
            |.|.:::|...:.|||:.:..|.....:|..:|:... .|::..:.|:|..|.:|:......|:.
plant   103 SNLNSVSLWGMTAITDSGVVQLISRTSSLQHLNIGGT-FITDESLFAIAERCHQLKTIGMWCCRH 166

  Fly   423 INDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQH 486
            :.:..::.|...|..|..:||.......|..|..|.          :|....:..:.||..:|:
plant   167 VTERGLLVLVNKCRKLESINLWGTRVPVDCFIALLT----------ISPALQIKPMELLLNAQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887 12/45 (27%)
leucine-rich repeat 280..307 CDD:275381 2/26 (8%)
AMN1 <308..453 CDD:187754 36/149 (24%)
leucine-rich repeat 308..327 CDD:275381 5/18 (28%)
leucine-rich repeat 334..359 CDD:275381 8/29 (28%)
leucine-rich repeat 360..385 CDD:275381 6/24 (25%)
leucine-rich repeat 386..411 CDD:275381 6/24 (25%)
AMN1 <409..586 CDD:187754 15/78 (19%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
leucine-rich repeat 438..463 CDD:275381 6/24 (25%)
leucine-rich repeat 464..515 CDD:275381 4/23 (17%)
leucine-rich repeat 516..541 CDD:275381
leucine-rich repeat 542..561 CDD:275381
leucine-rich repeat 571..595 CDD:275381
leucine-rich repeat 596..621 CDD:275381
AT5G67140NP_201515.1 F-box-like 7..>43 CDD:463757 11/44 (25%)
leucine-rich repeat 50..72 CDD:275381 6/22 (27%)
AMN1 <58..182 CDD:187754 29/125 (23%)
leucine-rich repeat 74..104 CDD:275381 8/29 (28%)
leucine-rich repeat 105..130 CDD:275381 6/24 (25%)
leucine-rich repeat 131..155 CDD:275381 6/24 (25%)
leucine-rich repeat 156..181 CDD:275381 4/24 (17%)
leucine-rich repeat 182..206 CDD:275381 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.