DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and AT5G51380

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_199951.1 Gene:AT5G51380 / 835212 AraportID:AT5G51380 Length:479 Species:Arabidopsis thaliana


Alignment Length:459 Identity:110/459 - (23%)
Similarity:176/459 - (38%) Gaps:132/459 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 ADQQRNMAGSAQDQSEDQSQTFLGATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNV 272
            |...|:...|......|..:|...:..|..:::::||:       |..:.|||     |||.|  
plant    44 AQSPRSRFKSLSSDFSDVDRTLSLSDSLLLKILEKLPE-------SQNEDVSL-----VCKRW-- 94

  Fly   273 LALDGSSWQKINLFDFQRDIEGPVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHL 337
            |::.|...:.:.:||::..:.|.::..       |.|..|:            .|.|.|.|    
plant    95 LSVQGRRLRSMKVFDWEFLLSGRLVSR-------FPKLTSV------------DLVNACFN---- 136

  Fly   338 DLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGV 402
                      .|:.|....|.  |:|:.|..   ||:||..      |.:|.::....:: :.|:
plant   137 ----------PSSNSGILLCH--TSISFHVS---TDSSLNL------NFVEESLLDNEMV-DKGL 179

  Fly   403 EALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKL 467
            ..|.||...|.|.......::   .::.||:.|.||..|.||.|   :|:.:|.:|| |..|:.|
plant   180 RVLGRGSFDLIKLVVINATEL---GLLSLAEDCSDLQELELHKC---SDNLLRGIAA-CENLRGL 237

  Fly   468 CVSKCAD------LTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLE-------RM 519
            .:....|      ::|:.|..|:|....|..||:|||....| |.:|:|:.|:.||       ||
plant   238 RLVGSVDGLYSSSVSDIGLTILAQGCKRLVKLELSGCEGSFD-GIKAIGQCCEVLEELSICDHRM 301

  Fly   520 D-----------------LEECSQI-TDLTLAHLATGCPSLEKLTLSHCELITDDGIRHL----- 561
            |                 :..|.:| :......|...||:||.|.|..|.|...:|:|.|     
plant   302 DDGWIAALSYFESLKTLLISSCRKIDSSPGPGKLLGSCPALESLQLRRCCLNDKEGMRALFKVCD 366

  Fly   562 -----TTGSC------------AAEILSVLELDNCPLITDRTLE------------HLVSCHNLQ 597
                 ....|            |...:..|.|:.|.::|...||            .:|||.|::
plant   367 GVTKVNIQDCWGLDDDSFSLAKAFRRVRFLSLEGCSILTTSGLESVILHWEELESMRVVSCKNIK 431

  Fly   598 RIEL 601
            ..|:
plant   432 DSEI 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 12/44 (27%)
leucine-rich repeat 280..307 CDD:275381 3/26 (12%)
AMN1 <308..453 CDD:187754 34/144 (24%)
leucine-rich repeat 308..327 CDD:275381 2/18 (11%)
leucine-rich repeat 334..359 CDD:275381 3/24 (13%)
leucine-rich repeat 360..385 CDD:275381 7/24 (29%)
leucine-rich repeat 386..411 CDD:275381 5/24 (21%)
AMN1 <409..586 CDD:187754 59/229 (26%)
leucine-rich repeat 412..437 CDD:275381 5/24 (21%)
leucine-rich repeat 438..463 CDD:275381 10/24 (42%)
leucine-rich repeat 464..515 CDD:275381 18/56 (32%)
leucine-rich repeat 516..541 CDD:275381 9/49 (18%)
leucine-rich repeat 542..561 CDD:275381 8/18 (44%)
leucine-rich repeat 571..595 CDD:275381 9/35 (26%)
leucine-rich repeat 596..621 CDD:275381 1/6 (17%)
AT5G51380NP_199951.1 AMN1 208..405 CDD:187754 54/201 (27%)
leucine-rich repeat 212..233 CDD:275381 10/24 (42%)
leucine-rich repeat 234..265 CDD:275381 7/30 (23%)
leucine-rich repeat 266..290 CDD:275381 11/24 (46%)
leucine-rich repeat 291..314 CDD:275381 5/22 (23%)
leucine-rich repeat 315..341 CDD:275381 4/25 (16%)
leucine-rich repeat 342..367 CDD:275381 9/24 (38%)
leucine-rich repeat 393..418 CDD:275381 6/24 (25%)
leucine-rich repeat 419..442 CDD:275381 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.