DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and AT5G23340

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_197725.1 Gene:AT5G23340 / 832398 AraportID:AT5G23340 Length:405 Species:Arabidopsis thaliana


Alignment Length:453 Identity:126/453 - (27%)
Similarity:188/453 - (41%) Gaps:110/453 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 DDELIKQLPKEVLLRVFSYLD--VVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIE 298
            ||||     :.||.|:.|..|  |..|     |||.|            :||....|        
plant    12 DDEL-----RWVLSRLDSDKDKEVFGL-----VCKRW------------LNLQSTDR-------- 46

  Fly   299 NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDC------KKITDISTQSISRYC 357
                      |.|:.|    .|...:|.||:....|..||||..      ..:||.....||...
plant    47 ----------KKLAAR----AGPHMLRRLASRFTQIVELDLSQSISRSFYPGVTDSDLAVISEGF 97

  Fly   358 SKLTAINLHSCSNITDNSLKYLSDGCPNLME-INVSWCHLISENGVEALARGCVKLRKFSSKGCK 421
            ..|..:|||:|..|||..|..:. .|.:|:: ::||:|..:|:.|:.|:|.||..||.....||:
plant    98 KFLRVLNLHNCKGITDTGLASIG-RCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCR 161

  Fly   422 QINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTD--------- 477
            .|.|.::..|::.|.||..|.|..|..||||.:..|...|.|::.|.::||:::.|         
plant   162 FITDESLKSLSERCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDINKCSNVGDAGVSSVAKA 226

  Fly   478 -------LTLL-----------SLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCK-YLERMDLEE 523
                   |.||           ||:|....|.||.:.|||:.:|.....|..:|| .|:.:.::.
plant   227 CASSLKTLKLLDCYKVGNESISSLAQFCKNLETLIIGGCRDISDESIMLLADSCKDSLKNLRMDW 291

  Fly   524 CSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLE 588
            |..|:|.:|:.:...|.:||.|.:..||.:||...|.|  ||.....|.||::.||..||...:.
plant   292 CLNISDSSLSCILKQCKNLEALDIGCCEEVTDTAFRDL--GSDDVLGLKVLKVSNCTKITVTGIG 354

  Fly   589 HLV-SCHNLQRIELFDCQLITRTAIRKLKNHLPNIKVHAYFAPGTPPAVTSGHRPRYCRCCEI 650
            .|: .|.:|:.|::.....:|.....:.....|                         :||::
plant   355 KLLDKCSSLEYIDVRSLPHVTEVRCSEAGLEFP-------------------------KCCKV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 11/46 (24%)
leucine-rich repeat 280..307 CDD:275381 3/26 (12%)
AMN1 <308..453 CDD:187754 52/151 (34%)
leucine-rich repeat 308..327 CDD:275381 5/18 (28%)
leucine-rich repeat 334..359 CDD:275381 9/30 (30%)
leucine-rich repeat 360..385 CDD:275381 10/24 (42%)
leucine-rich repeat 386..411 CDD:275381 10/25 (40%)
AMN1 <409..586 CDD:187754 65/204 (32%)
leucine-rich repeat 412..437 CDD:275381 8/24 (33%)
leucine-rich repeat 438..463 CDD:275381 10/24 (42%)
leucine-rich repeat 464..515 CDD:275381 20/78 (26%)
leucine-rich repeat 516..541 CDD:275381 6/24 (25%)
leucine-rich repeat 542..561 CDD:275381 8/18 (44%)
leucine-rich repeat 571..595 CDD:275381 9/24 (38%)
leucine-rich repeat 596..621 CDD:275381 3/24 (13%)
AT5G23340NP_197725.1 F-box_5 12..48 CDD:408301 18/75 (24%)
leucine-rich repeat 68..99 CDD:275381 9/30 (30%)
AMN1 85..323 CDD:187754 75/238 (32%)
leucine-rich repeat 100..125 CDD:275381 10/25 (40%)
leucine-rich repeat 126..151 CDD:275381 9/24 (38%)
leucine-rich repeat 152..177 CDD:275381 8/24 (33%)
leucine-rich repeat 178..203 CDD:275381 10/24 (42%)
leucine-rich repeat 204..230 CDD:275381 4/25 (16%)
leucine-rich repeat 231..256 CDD:275381 6/24 (25%)
leucine-rich repeat 257..283 CDD:275381 10/25 (40%)
leucine-rich repeat 284..309 CDD:275381 6/24 (25%)
leucine-rich repeat 310..336 CDD:275381 11/27 (41%)
leucine-rich repeat 337..362 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1195
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.