| Sequence 1: | NP_001097271.1 | Gene: | CG9003 / 36244 | FlyBaseID: | FBgn0033639 | Length: | 651 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_192272.1 | Gene: | AT4G03630 / 825663 | AraportID: | AT4G03630 | Length: | 220 | Species: | Arabidopsis thaliana |
| Alignment Length: | 207 | Identity: | 49/207 - (23%) |
|---|---|---|---|
| Similarity: | 75/207 - (36%) | Gaps: | 65/207 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 373 DNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPD 437
Fly 438 LMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGC---- 498
Fly 499 RNFTDIGF-----QALGRNCK---------------YLERMDLEECSQ-----ITDLTLAHLATG 538
Fly 539 CPSLEKLTLSHC 550 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9003 | NP_001097271.1 | F-box-like | 240..285 | CDD:289689 | |
| leucine-rich repeat | 280..307 | CDD:275381 | |||
| AMN1 | <308..453 | CDD:187754 | 14/79 (18%) | ||
| leucine-rich repeat | 308..327 | CDD:275381 | |||
| leucine-rich repeat | 334..359 | CDD:275381 | |||
| leucine-rich repeat | 360..385 | CDD:275381 | 2/11 (18%) | ||
| leucine-rich repeat | 386..411 | CDD:275381 | 6/24 (25%) | ||
| AMN1 | <409..586 | CDD:187754 | 41/171 (24%) | ||
| leucine-rich repeat | 412..437 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 438..463 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 464..515 | CDD:275381 | 19/74 (26%) | ||
| leucine-rich repeat | 516..541 | CDD:275381 | 8/29 (28%) | ||
| leucine-rich repeat | 542..561 | CDD:275381 | 5/9 (56%) | ||
| leucine-rich repeat | 571..595 | CDD:275381 | |||
| leucine-rich repeat | 596..621 | CDD:275381 | |||
| AT4G03630 | NP_192272.1 | AMN1 | <39..179 | CDD:187754 | 40/159 (25%) |
| leucine-rich repeat | 64..89 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 90..114 | CDD:275381 | 9/23 (39%) | ||
| leucine-rich repeat | 115..145 | CDD:275381 | 5/29 (17%) | ||
| leucine-rich repeat | 146..170 | CDD:275381 | 6/23 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||