DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and AT3G58530

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_567069.1 Gene:AT3G58530 / 825022 AraportID:AT3G58530 Length:353 Species:Arabidopsis thaliana


Alignment Length:350 Identity:100/350 - (28%)
Similarity:165/350 - (47%) Gaps:21/350 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 FQRDIEGPVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITD--IST 350
            ::|:|...|:..:|.|    |....|.....|.....|||.::......::|.:.....|  ::.
plant    14 WRREIVTSVMRLVSTR----LPQTDLISLLLVSPWLYRTLISYPSIWLTINLREMTNAGDRLLAA 74

  Fly   351 QSISRYCSKLTAINLHSCSNITDNSLKYLSDGCP----NLMEINVSWCHLISENGVEALARGCVK 411
            .|:.|| .::..|||.....:.|:.||.:...||    :|..:|::.|..||:||:||:...|.|
plant    75 LSLPRY-RQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNLNVCQKISDNGIEAITSICPK 138

  Fly   412 LRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLT 476
            |:.||.....::.|..|..|.|.|..:..|||..|:::||.|::.:|.:...|:.|.:::|..:|
plant   139 LKVFSIYWNVRVTDAGIRNLVKNCRHITDLNLSGCKSLTDKSMQLVAESYPDLESLNITRCVKIT 203

  Fly   477 DLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPS 541
            |..||.:.|....|.||.:.....|||..:..:..... |..:|:.....|:|..:.|:|. |..
plant   204 DDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKISLLAD-LRFLDICGAQNISDEGIGHIAK-CNK 266

  Fly   542 LEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHL-VSCH-NLQRIELFDC 604
            ||.|.|:.|..|||.|:..:.....:.|.||:..:..   :|||.||.| .:|. .|..:::..|
plant   267 LESLNLTWCVRITDAGVNTIANSCTSLEFLSLFGIVG---VTDRCLETLSQTCSTTLTTLDVNGC 328

  Fly   605 QLITRTAIRKLKNHLPNI---KVHA 626
            ..|.|.:..:|....|.:   |||:
plant   329 TGIKRRSREELLQMFPRLTCFKVHS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689
leucine-rich repeat 280..307 CDD:275381 5/18 (28%)
AMN1 <308..453 CDD:187754 44/150 (29%)
leucine-rich repeat 308..327 CDD:275381 4/18 (22%)
leucine-rich repeat 334..359 CDD:275381 5/26 (19%)
leucine-rich repeat 360..385 CDD:275381 8/28 (29%)
leucine-rich repeat 386..411 CDD:275381 10/24 (42%)
AMN1 <409..586 CDD:187754 53/176 (30%)
leucine-rich repeat 412..437 CDD:275381 8/24 (33%)
leucine-rich repeat 438..463 CDD:275381 8/24 (33%)
leucine-rich repeat 464..515 CDD:275381 14/50 (28%)
leucine-rich repeat 516..541 CDD:275381 7/24 (29%)
leucine-rich repeat 542..561 CDD:275381 9/18 (50%)
leucine-rich repeat 571..595 CDD:275381 9/25 (36%)
leucine-rich repeat 596..621 CDD:275381 5/24 (21%)
AT3G58530NP_567069.1 leucine-rich repeat 30..55 CDD:275381 6/24 (25%)
leucine-rich repeat 56..75 CDD:275381 2/18 (11%)
leucine-rich repeat 83..112 CDD:275381 8/28 (29%)
AMN1 113..342 CDD:187754 72/233 (31%)
leucine-rich repeat 113..138 CDD:275381 10/24 (42%)
leucine-rich repeat 139..164 CDD:275381 8/24 (33%)
leucine-rich repeat 165..190 CDD:275381 8/24 (33%)
leucine-rich repeat 191..216 CDD:275381 8/24 (33%)
leucine-rich repeat 217..266 CDD:275381 13/50 (26%)
leucine-rich repeat 267..292 CDD:275381 9/24 (38%)
leucine-rich repeat 293..318 CDD:275381 10/27 (37%)
leucine-rich repeat 320..339 CDD:275381 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.