DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and VFB2

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_566928.1 Gene:VFB2 / 824170 AraportID:AT3G50080 Length:522 Species:Arabidopsis thaliana


Alignment Length:416 Identity:103/416 - (24%)
Similarity:176/416 - (42%) Gaps:69/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LGATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEG 294
            :|..:.|.:....||.:.|..:|.:|......||:.|.|.|  |.:||.:..:::| |.:.:|. 
plant    31 IGFEDGDYDFTANLPDDCLAHIFQFLSAGDRKRCSLVSKRW--LLVDGQNRHRLSL-DAKSEIL- 91

  Fly   295 PVIENISQRCRGFLKSLSLRGCQ----SVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISR 355
            |.:..|..|.....| |:|| |.    |:.|:::..::..|.|:..:.|..|::|||:..:|.:|
plant    92 PFLPCIFNRFDSVTK-LALR-CDRRSFSLSDEALFIVSIRCSNLIRVKLRGCREITDLGMESFAR 154

  Fly   356 YCSKLTAIN--------------LHSCSNITDNSLKYLSDGCPNLME-INVSWCHLISENGVEAL 405
            .|..|..::              |..|..:.:.|||.:. |...|.| |.:|....:....::.|
plant   155 NCKSLRKLSCGSCTFGAKGINAMLEHCKVLEELSLKRIR-GLHELAEPIKLSLSASLRSVFLKEL 218

  Fly   406 ARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQL---------AANC 461
            ..|.|.....:::..|::  ..|.||..: ..:..:|.:...::|:..:.:|         .:.|
plant   219 VNGQVFGSLVATRTLKKV--KIIRCLGNW-DRVFEMNGNGNSSLTEIRLERLQVTDIGLFGISKC 280

  Fly   462 HKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSG-----------------CRNF-------- 501
            ..|:.|.:.|..|.::|.|.|:.:...||..|.:.|                 |.|.        
plant   281 SNLETLHIVKTPDCSNLGLASVVERCKLLRKLHIDGWRVKRIGDQGLMSVAKHCLNLQELVLIGV 345

  Fly   502 --TDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTG 564
              |.:...|:..|||.|||:.|.....|.|..:..:|..|.:|.|..:..| ||:|.|::.|..|
plant   346 DATYMSLSAIASNCKKLERLALCGSGTIGDAEIGCIAEKCVTLRKFCIKGC-LISDVGVQALALG 409

  Fly   565 SCAAEILSVLELDNCPLITDRTLEHL 590
             |..  |..|::..|.|:|....|.|
plant   410 -CPK--LVKLKVKKCSLVTGEVREWL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 13/44 (30%)
leucine-rich repeat 280..307 CDD:275381 6/26 (23%)
AMN1 <308..453 CDD:187754 37/163 (23%)
leucine-rich repeat 308..327 CDD:275381 7/22 (32%)
leucine-rich repeat 334..359 CDD:275381 8/24 (33%)
leucine-rich repeat 360..385 CDD:275381 7/38 (18%)
leucine-rich repeat 386..411 CDD:275381 6/25 (24%)
AMN1 <409..586 CDD:187754 50/212 (24%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
leucine-rich repeat 438..463 CDD:275381 4/33 (12%)
leucine-rich repeat 464..515 CDD:275381 17/77 (22%)
leucine-rich repeat 516..541 CDD:275381 8/24 (33%)
leucine-rich repeat 542..561 CDD:275381 7/18 (39%)
leucine-rich repeat 571..595 CDD:275381 7/20 (35%)
leucine-rich repeat 596..621 CDD:275381
VFB2NP_566928.1 F-box-like 42..>71 CDD:403981 9/28 (32%)
AMN1 <119..>187 CDD:187754 14/67 (21%)
leucine-rich repeat 133..158 CDD:275381 8/24 (33%)
leucine-rich repeat 159..183 CDD:275381 3/23 (13%)
leucine-rich repeat 233..258 CDD:275381 5/27 (19%)
leucine-rich repeat 259..282 CDD:275381 3/22 (14%)
AMN1 263..>410 CDD:187754 37/148 (25%)
leucine-rich repeat 283..308 CDD:275381 7/24 (29%)
leucine-rich repeat 309..336 CDD:275381 4/26 (15%)
leucine-rich repeat 337..361 CDD:275381 4/23 (17%)
leucine-rich repeat 362..387 CDD:275381 8/24 (33%)
leucine-rich repeat 388..412 CDD:275381 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.