DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and AT3G07550

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_566312.1 Gene:AT3G07550 / 819944 AraportID:AT3G07550 Length:395 Species:Arabidopsis thaliana


Alignment Length:433 Identity:99/433 - (22%)
Similarity:170/433 - (39%) Gaps:110/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 QDQSEDQSQTFLGATELDDELIKQLPKEVLLRVFSYLD-VVSLCRCAQVCKYW-NVLALDGSSWQ 281
            :|.||..:..        :..|..||.:.|..:|..|| |.........|..| |:..:...|.|
plant     2 EDVSESDNNV--------ETSIIHLPDDCLSFIFQRLDSVADHDSFGLTCHRWLNIQNISRRSLQ 58

  Fly   282 ---------KINLFDFQRDIEGPVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHL 337
                     ..:|.....|:....:..:..|.: :|:.|||.||..:.|.|:.:|......:..|
plant    59 FQCSFSVLNPSSLSQTNPDVSSHHLHRLLTRFQ-WLEHLSLSGCTVLNDSSLDSLRYPGARLHTL 122

  Fly   338 DLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGV 402
            .|..|..|:|....:|:.:|..|:.::|:.| ||:|..|:.|:....:|..:|:|:|.|:|:.|:
plant   123 YLDCCFGISDDGISTIASFCPNLSVVSLYRC-NISDIGLETLARASLSLKCVNLSYCPLVSDFGI 186

  Fly   403 EALARGCVKLRKFSSKGCKQI---------------------------------------NDNAI 428
            :||::.|::|.......||.|                                       |.:.:
plant   187 KALSQACLQLESVKISNCKSITGVGFSGCSPTLGYVDADSCQLEPKGITGIISGGGIEFLNISGV 251

  Fly   429 MCLAK----------YCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSL 483
            .|..:          ....|.:|||..|.|:.|.||..:|..|..||:..::.|           
plant   252 SCYIRKDGLVPIGSGIASKLRILNLRMCRTVGDESIEAIAKGCPLLQEWNLALC----------- 305

  Fly   484 SQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLS 548
                   :.:::|        |::|:|:.|:.|:::.:..|..:.|..|..|..||.:|:.|.: 
plant   306 -------HEVKIS--------GWEAVGKWCRNLKKLHVNRCRNLCDQGLLALRCGCMNLQILYM- 354

  Fly   549 HCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLV 591
                   :|...||  ..|.|:..:...|    ||.||.|.:|
plant   355 -------NGNARLT--PTAIEMFRLHRAD----ITLRTEEMMV 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 13/55 (24%)
leucine-rich repeat 280..307 CDD:275381 4/35 (11%)
AMN1 <308..453 CDD:187754 47/193 (24%)
leucine-rich repeat 308..327 CDD:275381 8/18 (44%)
leucine-rich repeat 334..359 CDD:275381 7/24 (29%)
leucine-rich repeat 360..385 CDD:275381 8/24 (33%)
leucine-rich repeat 386..411 CDD:275381 10/24 (42%)
AMN1 <409..586 CDD:187754 43/225 (19%)
leucine-rich repeat 412..437 CDD:275381 6/73 (8%)
leucine-rich repeat 438..463 CDD:275381 11/24 (46%)
leucine-rich repeat 464..515 CDD:275381 8/50 (16%)
leucine-rich repeat 516..541 CDD:275381 7/24 (29%)
leucine-rich repeat 542..561 CDD:275381 3/18 (17%)
leucine-rich repeat 571..595 CDD:275381 7/21 (33%)
leucine-rich repeat 596..621 CDD:275381
AT3G07550NP_566312.1 leucine-rich repeat 93..118 CDD:275381 9/24 (38%)
leucine-rich repeat 119..144 CDD:275381 7/24 (29%)
AMN1 142..361 CDD:187754 54/253 (21%)
leucine-rich repeat 145..169 CDD:275381 8/24 (33%)
leucine-rich repeat 170..195 CDD:275381 10/24 (42%)
leucine-rich repeat 196..270 CDD:275381 6/73 (8%)
leucine-rich repeat 271..296 CDD:275381 11/24 (46%)
leucine-rich repeat 297..322 CDD:275381 8/50 (16%)
leucine-rich repeat 323..346 CDD:275381 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.