DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and FBXL18

DIOPT Version :10

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001308142.1 Gene:FBXL18 / 80028 HGNCID:21874 Length:801 Species:Homo sapiens


Alignment Length:459 Identity:104/459 - (22%)
Similarity:171/459 - (37%) Gaps:132/459 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 DQSEDQSQTFL----------GATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLA 274
            |::......||          |||:   .|:..:.:.|:|...            |:.|.|    
Human   256 DRTPQNLHAFLISVPGSFAESGATK---NLLDSMARNVVLDAL------------QLPKSW---- 301

  Fly   275 LDGSS---WQKIN---LFDFQRDI--EGPVIENISQRCRGF--LKSLSLRGC------------- 316
            |:|||   ..|.|   .|.|.|..  .|.:|:.:....:..  |.||:|.||             
Human   302 LNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPDSLLRKA 366

  Fly   317 -QSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTA-------INLHSCSNITD 373
             ..:....:.||...|.|:.||:||...   ..|::.:.|:..:|.|       ::|..|| :.|
Human   367 EDDIDSSILETLVASCCNLRHLNLSAAH---HHSSEGLGRHLCQLLARLRHLRSLSLPVCS-VAD 427

  Fly   374 NSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRK---------FSSKGCKQINDNAIM 429
            ::.:  :|..|             ::..:.|:.||..|..:         ||.:.|.| ..:...
Human   428 SAPR--ADRAP-------------AQPAMHAVPRGFGKKVRVGVQSCPSPFSGQACPQ-PSSVFW 476

  Fly   430 CLAKYCP-----DLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTL---LSLSQH 486
            .|.|..|     :|:..|..|.....:.:||.....|.:.|.:..|:.|.:..|..   |:|:| 
Human   477 SLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHLTLAQ- 540

  Fly   487 NHLLNTLEVSG-------CRNFTDIGFQALGRNCK--YLERMD--LEECSQITDLTLA------- 533
              |.:.|..||       |:....:....||...|  |:..:.  |:.|.::.||.|.       
Human   541 --LPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLEQPYFSAN 603

  Fly   534 ----HLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVSCH 594
                ...:.||||::|    | |::..|.  |...:..|.:...|::..|.|.|.   |.|.:|.
Human   604 AQFFQALSQCPSLQRL----C-LVSRSGT--LQPDAVLAFMARCLQVVMCHLFTG---ESLATCK 658

  Fly   595 NLQR 598
            :||:
Human   659 SLQQ 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887 10/46 (22%)
leucine-rich repeat 280..307 CDD:275381 7/31 (23%)
AMN1 <308..453 CDD:187754 38/179 (21%)
leucine-rich repeat 308..327 CDD:275381 6/32 (19%)
leucine-rich repeat 334..359 CDD:275381 6/24 (25%)
leucine-rich repeat 360..385 CDD:275381 7/31 (23%)
leucine-rich repeat 386..411 CDD:275381 3/24 (13%)
AMN1 <409..586 CDD:187754 49/215 (23%)
leucine-rich repeat 412..437 CDD:275381 7/38 (18%)
leucine-rich repeat 438..463 CDD:275381 6/24 (25%)
leucine-rich repeat 464..515 CDD:275381 15/62 (24%)
leucine-rich repeat 516..541 CDD:275381 6/37 (16%)
leucine-rich repeat 542..561 CDD:275381 5/18 (28%)
leucine-rich repeat 571..595 CDD:275381 7/23 (30%)
leucine-rich repeat 596..621 CDD:275381 2/3 (67%)
FBXL18NP_001308142.1 F-box_FBXL18 28..71 CDD:438900
FBXL18_LRR 85..678 CDD:466163 104/459 (23%)
leucine-rich repeat 345..384 CDD:275381 9/38 (24%)
leucine-rich repeat 385..414 CDD:275381 8/31 (26%)
leucine-rich repeat 415..484 CDD:275381 16/85 (19%)
leucine-rich repeat 451..476 CDD:275381 4/25 (16%)
leucine-rich repeat 485..532 CDD:275381 10/46 (22%)
leucine-rich repeat 533..559 CDD:275381 8/28 (29%)
leucine-rich repeat 560..589 CDD:275381 6/28 (21%)
leucine-rich repeat 590..615 CDD:275381 4/24 (17%)
leucine-rich repeat 616..640 CDD:275381 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.