DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and amn1

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001038919.1 Gene:amn1 / 751744 ZFINID:ZDB-GENE-060825-13 Length:249 Species:Danio rerio


Alignment Length:183 Identity:61/183 - (33%)
Similarity:97/183 - (53%) Gaps:7/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 LNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIG 505
            |:|.:|: |:||:::|:  |...|:.:.:..||::|...|..|:.....|..::::||...||.|
Zfish    62 LDLQNCK-ISDSALKQI--NSLHLRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSG 123

  Fly   506 FQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEI 570
            .|||.|:||.||.:.|..||.::|..|..|...|..|..:..|..| :||.|:..|.||.|:.. 
Zfish   124 IQALARHCKCLEVISLRGCSALSDKALLELGGNCKMLHSIYFSGTE-VTDQGVIGLATGVCSCS- 186

  Fly   571 LSVLELDNCPLITDRTLEH-LVSCHNLQRIELFDCQLITRTAIRKLKNHL-PN 621
            |..|::..|..:||..:.. |.:|.|::......|.|||..:...|:|.: ||
Zfish   187 LKELQMVRCRNLTDLAVTAVLTNCANIRIFNFHGCPLITDKSREALQNLIGPN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689
leucine-rich repeat 280..307 CDD:275381
AMN1 <308..453 CDD:187754 5/11 (45%)
leucine-rich repeat 308..327 CDD:275381
leucine-rich repeat 334..359 CDD:275381
leucine-rich repeat 360..385 CDD:275381
leucine-rich repeat 386..411 CDD:275381
AMN1 <409..586 CDD:187754 50/144 (35%)
leucine-rich repeat 412..437 CDD:275381
leucine-rich repeat 438..463 CDD:275381 8/21 (38%)
leucine-rich repeat 464..515 CDD:275381 17/50 (34%)
leucine-rich repeat 516..541 CDD:275381 9/24 (38%)
leucine-rich repeat 542..561 CDD:275381 6/18 (33%)
leucine-rich repeat 571..595 CDD:275381 7/24 (29%)
leucine-rich repeat 596..621 CDD:275381 6/25 (24%)
amn1NP_001038919.1 AMN1 33..248 CDD:187754 61/183 (33%)
leucine-rich repeat 59..72 CDD:275381 4/10 (40%)
leucine-rich repeat 82..107 CDD:275381 6/24 (25%)
leucine-rich repeat 108..133 CDD:275381 11/24 (46%)
leucine-rich repeat 134..159 CDD:275381 9/24 (38%)
leucine-rich repeat 160..186 CDD:275381 10/26 (38%)
leucine-rich repeat 187..212 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.