DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and FipoQ

DIOPT Version :10

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:470 Identity:111/470 - (23%)
Similarity:187/470 - (39%) Gaps:137/470 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 DQSQTFLG----ATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKIN 284
            :.||.:|.    .:...|..|::||.:|||.:||||....:||.|::|:.|..:|.|...|:.::
  Fly    14 EASQVYLSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVS 78

  Fly   285 LFDFQRDIEG-------PVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDC 342
            |   :.::.|       .:::.||.|....|:.:.| ..:.:....:..|:..|.|:.|:     
  Fly    79 L---RPEVSGLHVGSLEMLLQLISVRFGPTLRYIEL-PIELITHTVLHELSAKCPNLTHM----- 134

  Fly   343 KKITDISTQSISRYCSKLTAINLHSCSNIT--DNSLKYLSDGCPNLMEINVSWCHLISE------ 399
              :.|.|           ||:.||..|.:.  ...|:|:   |..|.|:      :..|      
  Fly   135 --LLDFS-----------TAMQLHDFSEMQAFPTKLRYM---CVCLSEV------IFMEGFMRKI 177

  Fly   400 ----NGVEA--LARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLA 458
                ||:|.  |.....|..:...:..:.||   :..|....|:|.|:||:....|.||.|...:
  Fly   178 YNFINGLEVLHLIGTYEKCEEEEEEIYEVIN---VHKLKSATPNLRVINLYGINFIDDSHIDAFS 239

  Fly   459 ANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEE 523
            :||.:|:.|.|:.|..:|..||.:|.|.:..|..|.::|....::...||           :.::
  Fly   240 SNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQA-----------EWDK 293

  Fly   524 CS-QITDLTLAHLATGC--------PSLE----------------------------KLTLSHCE 551
            |: |..|:|...|:|.|        |||:                            .|.|...:
  Fly   294 CALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSD 358

  Fly   552 LITDDGI-------RHLTTGSCAAEI--------LSVLE-LDNCPLITDRTLEHL---------- 590
            .|:|:|:       .|..:..|.:.:        :|:|. |.||.:|...|.|.|          
  Fly   359 NISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLM 423

  Fly   591 ----VSCHNLQRIEL 601
                .:|.||:|:||
  Fly   424 DTIASNCGNLERLEL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887 18/43 (42%)
leucine-rich repeat 280..307 CDD:275381 6/33 (18%)
AMN1 <308..453 CDD:187754 34/158 (22%)
leucine-rich repeat 308..327 CDD:275381 2/18 (11%)
leucine-rich repeat 334..359 CDD:275381 3/24 (13%)
leucine-rich repeat 360..385 CDD:275381 8/26 (31%)
leucine-rich repeat 386..411 CDD:275381 7/36 (19%)
AMN1 <409..586 CDD:187754 52/229 (23%)
leucine-rich repeat 412..437 CDD:275381 3/24 (13%)
leucine-rich repeat 438..463 CDD:275381 10/24 (42%)
leucine-rich repeat 464..515 CDD:275381 14/50 (28%)
leucine-rich repeat 516..541 CDD:275381 7/33 (21%)
leucine-rich repeat 542..561 CDD:275381 6/53 (11%)
leucine-rich repeat 571..595 CDD:275381 10/38 (26%)
leucine-rich repeat 596..621 CDD:275381 4/6 (67%)
FipoQNP_733291.1 F-box-like 34..78 CDD:463757 18/43 (42%)
ING 110..>166 CDD:355795 16/77 (21%)
leucine-rich repeat 131..156 CDD:275381 8/42 (19%)
leucine-rich repeat 157..175 CDD:275381 6/26 (23%)
leucine-rich repeat 219..244 CDD:275381 10/24 (42%)
leucine-rich repeat 245..270 CDD:275381 9/24 (38%)
leucine-rich repeat 271..295 CDD:275381 5/34 (15%)
leucine-rich repeat 296..320 CDD:275381 6/23 (26%)
leucine-rich repeat 321..348 CDD:275381 1/26 (4%)
leucine-rich repeat 349..375 CDD:275381 5/25 (20%)
leucine-rich repeat 376..403 CDD:275381 5/26 (19%)

Return to query results.
Submit another query.