DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and CG12402

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster


Alignment Length:456 Identity:108/456 - (23%)
Similarity:194/456 - (42%) Gaps:80/456 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 TFLGATELDDELIKQLPKEVLLRVFSYL-----DVVSLCRCAQVCKYWNVLALDGSSWQKINL-- 285
            |......:||:.:..: .::.::.||:|     |.|||   ..|.|...:|.|..:. .|:.|  
  Fly   193 TIATTMSMDDQHLAAM-DDLDMKQFSHLVGFECDGVSL---DAVLKMRMLLQLRRTE-NKVQLRH 252

  Fly   286 --FDFQRDIEGPVIENISQR----------------------CRGF-----LKSLSLRG-CQSVG 320
              |:|:|:.|..:::.:...                      ||.|     |::|.|.| |..|.
  Fly   253 LQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVL 317

  Fly   321 DQSVRTLANHCHNIEHLDLSDCKKIT-DISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCP 384
            .::|.........|..|||:....:| ::......::.|.|..::|..|..:..|.:..|.....
  Fly   318 LEAVLRAVPESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSG 382

  Fly   385 NLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQIN-------DNAIMC-LAKYCPDLMVL 441
            .|..:.:::|..::..|   |.:|......:|   .::::       |.:.|| |.:..|:|..|
  Fly   383 RLEALTMAYCRELTGTG---LLQGLAGDINYS---LQELHLEETIFLDESSMCQLLERLPNLRRL 441

  Fly   442 NLHSC-ETITDSSIRQLAANCH---KLQKLCVSKCADLTDLTLLSLSQHNHL------LNTLEVS 496
            :|.:| :.:||   |.:|..|.   :|:.|.:..|..:||..|:......:.      |..|.:.
  Fly   442 SLDNCRQAVTD---RTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLR 503

  Fly   497 GCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHL 561
            ||||.||.... :|.....|..:.|..|:::|......|...|||||.|.:|.|..:.|:.:.::
  Fly   504 GCRNVTDSSLM-VGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNI 567

  Fly   562 TTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQ---LITRTAIRKLKNHLPNI 622
            .:.   .:.|.||.|.||..:|.:::.|::: .|||  ::|..|.   :....|.|.|::..|.:
  Fly   568 VSN---LKRLRVLNLSNCTKLTLQSIHHILAHGHNL--VQLIACSIDGMDHEQAQRILESQRPQM 627

  Fly   623 K 623
            |
  Fly   628 K 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 12/49 (24%)
leucine-rich repeat 280..307 CDD:275381 8/52 (15%)
AMN1 <308..453 CDD:187754 35/155 (23%)
leucine-rich repeat 308..327 CDD:275381 7/19 (37%)
leucine-rich repeat 334..359 CDD:275381 5/25 (20%)
leucine-rich repeat 360..385 CDD:275381 5/24 (21%)
leucine-rich repeat 386..411 CDD:275381 5/24 (21%)
AMN1 <409..586 CDD:187754 51/194 (26%)
leucine-rich repeat 412..437 CDD:275381 5/32 (16%)
leucine-rich repeat 438..463 CDD:275381 9/28 (32%)
leucine-rich repeat 464..515 CDD:275381 15/56 (27%)
leucine-rich repeat 516..541 CDD:275381 6/24 (25%)
leucine-rich repeat 542..561 CDD:275381 6/18 (33%)
leucine-rich repeat 571..595 CDD:275381 8/24 (33%)
leucine-rich repeat 596..621 CDD:275381 6/27 (22%)
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 3/21 (14%)
LRR_RI <297..482 CDD:238064 44/193 (23%)
leucine-rich repeat 304..330 CDD:275381 7/25 (28%)
leucine-rich repeat 331..357 CDD:275381 5/25 (20%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 5/27 (19%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 48/171 (28%)
leucine-rich repeat 438..464 CDD:275381 9/28 (32%)
leucine-rich repeat 465..496 CDD:275381 6/30 (20%)
leucine-rich repeat 497..521 CDD:275381 9/24 (38%)
leucine-rich repeat 522..547 CDD:275381 6/24 (25%)
leucine-rich repeat 548..573 CDD:275381 6/27 (22%)
leucine-rich repeat 574..599 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457981
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.