DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and CG7148

DIOPT Version :10

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster


Alignment Length:382 Identity:76/382 - (19%)
Similarity:125/382 - (32%) Gaps:136/382 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LIKQLPKEVLLRVFSYL-DVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEG-----PVI 297
            ||.||..:.|..:|..| |:.|....|:.|:....:.|  |.|:..:.:: |.|:|.     |..
  Fly     8 LILQLDDDCLAEIFDRLQDLPSEVSFARTCRRVQYICL--SKWRTSHAYE-QLDLEKWRVLLPNH 69

  Fly   298 ENI---SQRCRGFLKSLSLRGCQ-SV-----------------------------GDQSVRTLA- 328
            |::   ..:.|.:::.:....|. |:                             .::|:|.|| 
  Fly    70 EDLVYFLTQMRPYIREMGGSSCLCSILKDLDEMHIAELPMVTSFYYDPDGVDCYPTNRSIRKLAR 134

  Fly   329 ----------------NHCHNIEHLD------------------LSD-CKKITDISTQSISRY-- 356
                            .:..|.:||.                  |.: |:.:.|:....|..|  
  Fly   135 LLPGLKKLRLTTPIDGRYLSNFQHLQELHLYEDQHKAFELQQKYLDEVCRTLHDLRVLDIRTYDM 199

  Fly   357 CSKLTAIN-LHSCSNITDNSLKY--LSDGCPNLME----------INVSWCH---LISENGVEAL 405
            .|||...| |.|..|:||..|..  |....|.::|          ::..| |   |:|.:..:..
  Fly   200 ISKLQLGNCLQSFKNLTDLKLNLATLKPILPAVLELPSLRKLVVLLDNEW-HIPPLVSPDSYDHK 263

  Fly   406 ARGCVKLRKFSSKGCKQINDNAI-------------------------MCLAKYCPDLMVLNLHS 445
            .|...:..:..:...|.|...|:                         :.:..:......|..::
  Fly   264 IREVSEFYEIMAFKAKDIVGFAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICSWTHSADYLKRYT 328

  Fly   446 CETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFT 502
            |.|              :||.|||....||:|..||...:....|..|:||.|||.|
  Fly   329 CMT--------------ELQLLCVRNWNDLSDEILLEFVELCPRLEHLDVSYCRNLT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887 13/42 (31%)
leucine-rich repeat 280..307 CDD:275381 7/34 (21%)
AMN1 <308..453 CDD:187754 38/253 (15%)
leucine-rich repeat 308..327 CDD:275381 4/48 (8%)
leucine-rich repeat 334..359 CDD:275381 7/45 (16%)
leucine-rich repeat 360..385 CDD:275381 9/27 (33%)
leucine-rich repeat 386..411 CDD:275381 6/37 (16%)
AMN1 <409..586 CDD:187754 24/119 (20%)
leucine-rich repeat 412..437 CDD:275381 3/49 (6%)
leucine-rich repeat 438..463 CDD:275381 3/24 (13%)
leucine-rich repeat 464..515 CDD:275381 18/39 (46%)
leucine-rich repeat 516..541 CDD:275381
leucine-rich repeat 542..561 CDD:275381
leucine-rich repeat 571..595 CDD:275381
leucine-rich repeat 596..621 CDD:275381
CG7148NP_649366.1 F-box_SF 9..47 CDD:459239 11/39 (28%)
leucine-rich repeat 333..358 CDD:275381 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.