DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and CG9316

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster


Alignment Length:465 Identity:102/465 - (21%)
Similarity:177/465 - (38%) Gaps:115/465 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 NMAGSAQDQSEDQSQTFLGATELDDELIKQLPKEVLLRVFSYLDVVS---LCRC----------- 263
            |..|..|......|.:.|..|.|.|     ||::::..|..:|..::   |..|           
  Fly    20 NRPGGVQKSEPSPSPSPLCRTSLLD-----LPEDIIRLVLEFLPRITDKVLLACVAPKFRAAFEG 79

  Fly   264 -AQVCKYWNVLALDGSSWQKINLFDFQR--DIEGPVIENISQRCRGFLKSLSLRGCQSVGDQSVR 325
             |:|.:.    |||..|.:.:.|....|  .:.||.|..:...|..:.|...|          |.
  Fly    80 WARVQRN----ALDMVSLETVPLPQLIRFFKVAGPFIRVLQVDCASYQKESLL----------VE 130

  Fly   326 TLANHCHNIEHLDLSDCKKITD-ISTQSISRYCSKLTAINLHSCSNITD---------NSLKY-- 378
            .:..:|.|:|.:..|:.   || ...:||....:.|..:.: .|.:..|         ..|::  
  Fly   131 FVKEYCPNLEEISYSNA---TDEFHYRSIMSKMTHLKRVTI-ECLDAEDVLNFDMQPNQELEFFE 191

  Fly   379 LSDGC---------PNLMEINVSWCHLIS--ENGVEALARGCVKLRKFSSKGC--KQINDNAIMC 430
            |.:||         |||..:.:..|.|.:  |.|:...:     |.......|  :.:|.:....
  Fly   192 LVNGCYTGQNLCGFPNLKTLVLRDCLLWNSMEFGIPLKS-----LHTLDLDDCCFEVMNVSLYQK 251

  Fly   431 LAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKC------ADLTDLTLLSLSQHNHL 489
            :|:.|.:|:.|....|:|..     ::.||..||:: |..|.      .::..||:|:..:.|.|
  Fly   252 IAESCTNLVELIFSGCDTNF-----EVIANLPKLER-CTLKTWMTSNELNIGFLTVLAEKRGNKL 310

  Fly   490 LNTLEVSGCRNFTDIGFQALGR------------------------NCKYLERMDLEECSQITDL 530
            .: |.:||..|.|:...:.||:                        :...|||..|..|.::.|:
  Fly   311 TH-LHLSGQFNITNEHARCLGQLSSLTDLRFSNNDILDDDHFKFFNDLSQLERFGLTACGRVMDV 374

  Fly   531 TLAHLATGCPSLEKLTLSHCELITDD----GIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLV 591
            .:..:...||.|:.:.|:.||.||::    .|...:.||....:|:|    ...:|....|.|..
  Fly   375 GMMRMLRKCPQLKVIDLTDCEQITEEFVIQAIGFCSKGSGRDVVLNV----KGTMIRRPILTHPD 435

  Fly   592 SCHNLQRIEL 601
            ..::|.|:::
  Fly   436 YVNSLNRLKV 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 12/59 (20%)
leucine-rich repeat 280..307 CDD:275381 6/28 (21%)
AMN1 <308..453 CDD:187754 34/169 (20%)
leucine-rich repeat 308..327 CDD:275381 3/18 (17%)
leucine-rich repeat 334..359 CDD:275381 6/25 (24%)
leucine-rich repeat 360..385 CDD:275381 7/44 (16%)
leucine-rich repeat 386..411 CDD:275381 5/26 (19%)
AMN1 <409..586 CDD:187754 47/212 (22%)
leucine-rich repeat 412..437 CDD:275381 5/26 (19%)
leucine-rich repeat 438..463 CDD:275381 6/24 (25%)
leucine-rich repeat 464..515 CDD:275381 15/80 (19%)
leucine-rich repeat 516..541 CDD:275381 7/24 (29%)
leucine-rich repeat 542..561 CDD:275381 7/22 (32%)
leucine-rich repeat 571..595 CDD:275381 5/23 (22%)
leucine-rich repeat 596..621 CDD:275381 2/6 (33%)
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 3/12 (25%)
leucine-rich repeat 231..258 CDD:275381 5/26 (19%)
leucine-rich repeat 259..279 CDD:275381 6/24 (25%)
leucine-rich repeat 280..309 CDD:275381 6/29 (21%)
AMN1 310..>411 CDD:187754 23/101 (23%)
leucine-rich repeat 310..334 CDD:275381 8/24 (33%)
leucine-rich repeat 335..359 CDD:275381 0/23 (0%)
leucine-rich repeat 360..385 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.