DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and Fbxl21

DIOPT Version :10

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:418 Identity:97/418 - (23%)
Similarity:166/418 - (39%) Gaps:107/418 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 TFLGATELDDELIK--QLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQR 290
            |.|..|::...|:.  .||..|:||:|.||.:|...|.:.||:.||.:......|:|   |:|: 
  Rat    54 TSLRQTQMLSALLDWGTLPHHVILRIFQYLPLVDRARASSVCRSWNEVFHIPDLWRK---FEFE- 114

  Fly   291 DIEGPVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISR 355
                     ::|....:.||       :..|...:.:..|..:::::...     .|.||:|...
  Rat   115 ---------LNQSATSYFKS-------THPDLIQQIIKKHAAHLQYVSFK-----VDSSTESAEA 158

  Fly   356 YCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGC 420
            .|..|:  .|.:||..|   |..:|...|:.|  |:...|.:|     ||....|..:..||   
  Rat   159 ACHILS--QLVNCSIQT---LGLISTAKPSFM--NMPKSHFVS-----ALTVVFVNSKSLSS--- 208

  Fly   421 KQINDNAI------MCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLT 479
            .:|.|..:      :.:|.....|.:|.:.||..::...|..:|.:|..|::|.::... |:|..
  Rat   209 IKIEDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGILCVADHCQGLRELALNYYI-LSDEL 272

  Fly   480 LLSLSQHNHL-LNTLEVS------GCRNFTDI---GFQALGRNCK----------YLERMD--LE 522
            ||:||...|: |..|.:.      |...|..|   .:.||.::..          |.|..|  .:
  Rat   273 LLALSSETHVNLEHLRIDVVSENPGQIKFHSIKKPSWDALVKHSPGVNVVMYFFLYEEEFDTFFK 337

  Fly   523 ECSQITDL---------TLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDN 578
            |.:.:|.|         .|..:...||.|.:|      ::..:|::.|.     :|::       
  Rat   338 EETPVTHLYFGRSVSRTILGRIGLNCPRLIEL------VVCANGLQPLD-----SELI------- 384

  Fly   579 CPLITDRTLEHLVSCHNLQRIELFDCQL 606
                  |..||   |.||..:.|.:|::
  Rat   385 ------RIAEH---CKNLTALGLSECEV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887 15/45 (33%)
leucine-rich repeat 280..307 CDD:275381 5/26 (19%)
AMN1 <308..453 CDD:187754 33/150 (22%)
leucine-rich repeat 308..327 CDD:275381 3/18 (17%)
leucine-rich repeat 334..359 CDD:275381 5/24 (21%)
leucine-rich repeat 360..385 CDD:275381 7/24 (29%)
leucine-rich repeat 386..411 CDD:275381 6/24 (25%)
AMN1 <409..586 CDD:187754 43/213 (20%)
leucine-rich repeat 412..437 CDD:275381 5/30 (17%)
leucine-rich repeat 438..463 CDD:275381 7/24 (29%)
leucine-rich repeat 464..515 CDD:275381 16/70 (23%)
leucine-rich repeat 516..541 CDD:275381 7/35 (20%)
leucine-rich repeat 542..561 CDD:275381 3/18 (17%)
leucine-rich repeat 571..595 CDD:275381 4/23 (17%)
leucine-rich repeat 596..621 CDD:275381 3/11 (27%)
Fbxl21XP_038951543.1 F-box_SF 66..108 CDD:459239 14/41 (34%)
FBXL21_LRR 111..460 CDD:467831 77/358 (22%)
leucine-rich repeat 206..231 CDD:275381 5/27 (19%)
leucine-rich repeat 232..257 CDD:275381 7/24 (29%)
leucine-rich repeat 258..283 CDD:275381 9/25 (36%)
leucine-rich repeat 284..318 CDD:275381 7/33 (21%)
leucine-rich repeat 329..365 CDD:275381 7/35 (20%)
leucine-rich repeat 366..392 CDD:275381 9/52 (17%)
leucine-rich repeat 393..418 CDD:275381 3/11 (27%)

Return to query results.
Submit another query.