DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and AT4G08535

DIOPT Version :10

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001328273.1 Gene:AT4G08535 / 28719998 AraportID:AT4G08535 Length:291 Species:Arabidopsis thaliana


Alignment Length:319 Identity:75/319 - (23%)
Similarity:115/319 - (36%) Gaps:85/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 TLANHCHN----IEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDG---- 382
            |:.|.|..    ..|:||:...|..|...              ||:..|.:...|:.|..|    
plant    15 TMFNKCAMDPLCYSHIDLTKAFKYVDDRV--------------LHTLLNRSGKQLRSLKLGRVDA 65

  Fly   383 --------C-PNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGC---KQINDNAIMCLAKYC 435
                    | |.|:....|....: :.|.:|.:.||     |.::.|   .::..|.:..|..| 
plant    66 PGSVFRSSCLPPLIHYRNSASRSL-KLGRDAPSPGC-----FFTRSCLDPLKLTGNLLTSLHIY- 123

  Fly   436 PDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRN 500
                .|...:.:::.||                :|.|::||||.::.:   |.||..:       
plant   124 ----FLGFMNMDSLLDS----------------LSACSNLTDLKIVGV---NVLLEPI------- 158

  Fly   501 FTDIGFQALGRNCKYLERMDLEECSQ--ITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTT 563
                 .:.|.|.|..:|.:.|:.|.|  ||..|:....|.|..:..|||....| .|...:.|.|
plant   159 -----LELLARKCCLIEHLFLDNCYQGMITYPTIKLFVTNCLKITSLTLLDFRL-NDAMAQILVT 217

  Fly   564 GSCAAEILSVLELDNCPLITD---RTLEHLVSCHNLQRIELFDCQLITRTAIRKLKNHL 619
            |   ..||..:.|.|...||.   |.|.|..:...||.:.|.||..:....:.:..|.|
plant   218 G---FRILKYINLSNTAGITGSFLRNLGHRSNDSPLQTLILRDCFSLQEREVVEFLNSL 273

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887
leucine-rich repeat 280..307 CDD:275381
AMN1 <308..453 CDD:187754 29/146 (20%)