DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9003 and pof2

DIOPT Version :9

Sequence 1:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_596079.1 Gene:pof2 / 2540355 PomBaseID:SPBC25B2.11 Length:463 Species:Schizosaccharomyces pombe


Alignment Length:451 Identity:110/451 - (24%)
Similarity:194/451 - (43%) Gaps:89/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 QLPKEVLLRVFSYLDVVSLCRC-AQVCKYWNVLALDGSSWQKI---------NLFD---FQRDIE 293
            ::|.||...:.|||:...| || :.||..|....:. :.|:|:         |.||   :.:|:.
pombe     2 RVPNEVCFNILSYLEADEL-RCKSTVCTSWRNFIIP-TLWEKVVFQNEAQLNNFFDTLQYSKDVS 64

  Fly   294 --GPVIENIS-QRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISR 355
              ...:..:: .|.|.||....|         .:.|||.   .|..|:||.|.:|::.....:..
pombe    65 YYFRYLRKLNCSRVRKFLTDKHL---------MLMTLAT---GISRLNLSGCTRISEPLIGKLLY 117

  Fly   356 YCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGC 420
            ....|..||..:..::..|.|:|:||.||||..:|:..|.|:.:.|:..:.:.|..|.:.....|
pombe   118 QNLNLVTINFSNIFSLPANILEYISDNCPNLKALNIGNCGLVEDTGMVQIIKRCPYLNRLIIPNC 182

  Fly   421 KQINDNAIMCLAKYCPDLMVLNLHSCE-------------------------------------- 447
            :::.|.::..|::. .||:.|::..||                                      
pombe   183 RKLTDVSLQILSEK-EDLIELDISGCEGFHNADTLSRLVSRNRGLKELSMDGCTELSHFITFLNL 246

  Fly   448 ----------------TITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVS 496
                            .:.||.|..:.....||..|.:|||..|||.:||||::.:..|.||.:.
pombe   247 NCELDAMRALSLNNLPDLKDSDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTKLSQSLTTLHLG 311

  Fly   497 GCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHL 561
            .|...||||.|.|.::||.:..:|...|.:::|:.::.:|. .|.|:::.|..|..:||..: .|
pombe   312 HCYEITDIGVQCLLKSCKNITYIDFGGCLRLSDIAVSAIAK-LPYLQRVGLVKCICLTDLSV-IL 374

  Fly   562 TTGSCAAEILSVLELDNCPLITDRTLEHLV-SCHNLQRIELFDCQLITRTAIRKLKNHLPN 621
            .:||.:.. |..:.|..|..:|.:::.:|: :|..|:.:.:.....|..|.:|.....:|:
pombe   375 LSGSFSRN-LERVHLSYCIGLTAKSVSYLMYNCKTLKHLSVTGINSILCTELRSFSRPIPD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 14/52 (27%)
leucine-rich repeat 280..307 CDD:275381 8/41 (20%)
AMN1 <308..453 CDD:187754 38/198 (19%)
leucine-rich repeat 308..327 CDD:275381 2/18 (11%)
leucine-rich repeat 334..359 CDD:275381 6/24 (25%)
leucine-rich repeat 360..385 CDD:275381 9/24 (38%)
leucine-rich repeat 386..411 CDD:275381 6/24 (25%)
AMN1 <409..586 CDD:187754 55/230 (24%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
leucine-rich repeat 438..463 CDD:275381 7/78 (9%)
leucine-rich repeat 464..515 CDD:275381 23/50 (46%)
leucine-rich repeat 516..541 CDD:275381 4/24 (17%)
leucine-rich repeat 542..561 CDD:275381 5/18 (28%)
leucine-rich repeat 571..595 CDD:275381 6/24 (25%)
leucine-rich repeat 596..621 CDD:275381 4/24 (17%)
pof2NP_596079.1 F-box-like 2..45 CDD:289689 14/44 (32%)
leucine-rich repeat 96..121 CDD:275381 6/24 (25%)
leucine-rich repeat 122..141 CDD:275381 5/18 (28%)
AMN1 <143..292 CDD:187754 29/149 (19%)
leucine-rich repeat 148..173 CDD:275381 6/24 (25%)
leucine-rich repeat 174..225 CDD:275381 9/51 (18%)
leucine-rich repeat 226..278 CDD:275381 3/51 (6%)
AMN1 <278..428 CDD:187754 48/152 (32%)
leucine-rich repeat 279..304 CDD:275381 12/24 (50%)
leucine-rich repeat 305..330 CDD:275381 11/24 (46%)
leucine-rich repeat 331..355 CDD:275381 4/24 (17%)
leucine-rich repeat 356..382 CDD:275381 8/26 (31%)
leucine-rich repeat 383..408 CDD:275381 6/24 (25%)
leucine-rich repeat 409..427 CDD:275381 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68784
Inparanoid 1 1.050 116 1.000 Inparanoid score I1532
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47209
orthoMCL 1 0.900 - - OOG6_101086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2139
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.