Sequence 1: | NP_001097271.1 | Gene: | CG9003 / 36244 | FlyBaseID: | FBgn0033639 | Length: | 651 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106895.1 | Gene: | Amn1 / 232566 | MGIID: | 2442933 | Length: | 258 | Species: | Mus musculus |
Alignment Length: | 258 | Identity: | 77/258 - (29%) |
---|---|---|---|
Similarity: | 132/258 - (51%) | Gaps: | 35/258 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 SISRYCSKLTAINLHSCSNITDNSLKYLS-DGCPNLMEINVSWCHLISENGVEALARGCVKLRKF 415
Fly 416 SSKGCKQINDNAIMCLAKYCPDLMVLNLHSC----ETITDSSIRQLAANCHKLQKLCVSKCADLT 476
Fly 477 DLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATG--C 539
Fly 540 PSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRT---LEHLVSCHNLQRI 599 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9003 | NP_001097271.1 | F-box-like | 240..285 | CDD:289689 | |
leucine-rich repeat | 280..307 | CDD:275381 | |||
AMN1 | <308..453 | CDD:187754 | 31/105 (30%) | ||
leucine-rich repeat | 308..327 | CDD:275381 | |||
leucine-rich repeat | 334..359 | CDD:275381 | 4/6 (67%) | ||
leucine-rich repeat | 360..385 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 386..411 | CDD:275381 | 4/24 (17%) | ||
AMN1 | <409..586 | CDD:187754 | 56/182 (31%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 438..463 | CDD:275381 | 11/28 (39%) | ||
leucine-rich repeat | 464..515 | CDD:275381 | 18/50 (36%) | ||
leucine-rich repeat | 516..541 | CDD:275381 | 6/26 (23%) | ||
leucine-rich repeat | 542..561 | CDD:275381 | 5/18 (28%) | ||
leucine-rich repeat | 571..595 | CDD:275381 | 11/26 (42%) | ||
leucine-rich repeat | 596..621 | CDD:275381 | 1/4 (25%) | ||
Amn1 | NP_001106895.1 | leucine-rich repeat | 15..38 | CDD:275381 | 8/20 (40%) |
AMN1 | 37..257 | CDD:187754 | 69/238 (29%) | ||
leucine-rich repeat | 63..86 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 87..116 | CDD:275381 | 11/28 (39%) | ||
leucine-rich repeat | 117..142 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 143..168 | CDD:275381 | 10/24 (42%) | ||
leucine-rich repeat | 169..195 | CDD:275381 | 6/26 (23%) | ||
leucine-rich repeat | 196..221 | CDD:275381 | 7/27 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1046098at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |