| Sequence 1: | NP_001097271.1 | Gene: | CG9003 / 36244 | FlyBaseID: | FBgn0033639 | Length: | 651 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001106873.1 | Gene: | AMN1 / 196394 | HGNCID: | 27281 | Length: | 258 | Species: | Homo sapiens |
| Alignment Length: | 260 | Identity: | 73/260 - (28%) |
|---|---|---|---|
| Similarity: | 133/260 - (51%) | Gaps: | 37/260 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 351 QSISRYCSKLTAINLHSCSNITDNSLKYLS-DGCPNLMEINVSWCHLISENGVEAL-ARGCVKLR 413
Fly 414 KFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCE----TITDSSIRQLAANCHKLQKLCVSKCAD 474
Fly 475 LTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATG- 538
Fly 539 -CPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRT---LEHLVSCHNLQRI 599
Fly 600 599 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9003 | NP_001097271.1 | F-box-like | 240..285 | CDD:289689 | |
| leucine-rich repeat | 280..307 | CDD:275381 | |||
| AMN1 | <308..453 | CDD:187754 | 27/107 (25%) | ||
| leucine-rich repeat | 308..327 | CDD:275381 | |||
| leucine-rich repeat | 334..359 | CDD:275381 | 4/7 (57%) | ||
| leucine-rich repeat | 360..385 | CDD:275381 | 6/25 (24%) | ||
| leucine-rich repeat | 386..411 | CDD:275381 | 7/25 (28%) | ||
| AMN1 | <409..586 | CDD:187754 | 52/182 (29%) | ||
| leucine-rich repeat | 412..437 | CDD:275381 | 5/24 (21%) | ||
| leucine-rich repeat | 438..463 | CDD:275381 | 8/28 (29%) | ||
| leucine-rich repeat | 464..515 | CDD:275381 | 17/50 (34%) | ||
| leucine-rich repeat | 516..541 | CDD:275381 | 6/26 (23%) | ||
| leucine-rich repeat | 542..561 | CDD:275381 | 6/18 (33%) | ||
| leucine-rich repeat | 571..595 | CDD:275381 | 11/26 (42%) | ||
| leucine-rich repeat | 596..621 | CDD:275381 | 1/4 (25%) | ||
| AMN1 | NP_001106873.1 | AMN1 | 37..257 | CDD:187754 | 67/239 (28%) |
| leucine-rich repeat | 63..86 | CDD:275381 | 9/35 (26%) | ||
| leucine-rich repeat | 87..116 | CDD:275381 | 8/28 (29%) | ||
| leucine-rich repeat | 117..142 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 143..168 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 169..195 | CDD:275381 | 6/26 (23%) | ||
| leucine-rich repeat | 196..221 | CDD:275381 | 8/25 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1046098at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||