DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9005 and AT5G41110

DIOPT Version :9

Sequence 1:NP_001369081.1 Gene:CG9005 / 36243 FlyBaseID:FBgn0033638 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_001332177.1 Gene:AT5G41110 / 834113 AraportID:AT5G41110 Length:621 Species:Arabidopsis thaliana


Alignment Length:505 Identity:125/505 - (24%)
Similarity:180/505 - (35%) Gaps:170/505 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   914 PAQLRLNCGSNLLESETPPPMTSPQMRKA--LP------KVNL-------TTIFCS------SAP 957
            |.:.|   |.:|..|.:..||||..:.|.  :|      |.|:       ||..||      |..
plant   153 PEKFR---GDSLDISHSNQPMTSAGLPKGFHIPVGQDHKKANISGRLRLFTTSNCSEWGNDTSHT 214

  Fly   958 IAIGCPAFSFDPAALSHARSQLLAPDVSV---TPPVQKSFSAPT--LPHAASLSVS--------- 1008
            ..:....|:..|...|:.    |.|...|   ..||.::|..|.  ||...::|||         
plant   215 GKLSSTVFTDGPLLDSND----LQPSQDVHCLYSPVHETFQVPNKPLPCHRNISVSPPLSLSPLG 275

  Fly  1009 PRFSKQALAAH---------------------KRRSRHLSDRSDRSSLGSDEQLS-DEDLESGLC 1051
            ||||::..|..                     :.|:.|   ||...:.|.....| |..:||...
plant   276 PRFSERMKALQGGLNGNIFEDDVCLKNTGEEAELRTGH---RSFDDTNGIQRAFSMDRAIESVPT 337

  Fly  1052 SPAGGSPLKCRARLAAQFGGRP----LLGNLEESLLQRRLM-----PKIEVMGFTLQLGASGG-- 1105
            ||       |: |.:....|||    |:|:.||||...||.     .||:  ||...|..:||  
plant   338 SP-------CK-RFSRSLSGRPIQRSLVGSFEESLFSGRLSYGQANQKID--GFLAILSIAGGNI 392

  Fly  1106 --------FCPTQVNIPAVSYFY------------ELHGETLST-PYLCEIRLPRKGYSVPRSGT 1149
                    |..|.|.......:|            :|.|:.|.| ....:.:...|...:|..|.
plant   393 SPKSQKLPFSVTSVGDDCFLLYYASIDLSGGSLPSKLWGQKLKTNQNKSDAQTINKRLRIPMKGR 457

  Fly  1150 VQATLLNPIGTVVRMFVIPYDMRDMPPLHRTFIRQRI----------------------LAEELS 1192
            :|..|.||..|.:..|:..||:.|||...:||:||::                      |.:||.
plant   458 IQLVLSNPEKTPLHTFLCNYDLTDMPHGTKTFLRQKVTLASSVPTKAKKSANKGSEGSELVDELH 522

  Fly  1193 QDQDEGHKVPRSPTVTSTTSKLGHFISAEQMKRLRYSIHLKF------QTSRSG----------- 1240
            ...:.|:|..|     .|..:.|...|...:  |||::||||      :.|:.|           
plant   523 SPNECGNKNCR-----ETYRETGQRCSKSGV--LRYALHLKFICPLRKKASKLGQKKSLDAGDDG 580

  Fly  1241 --RLCLHTDIRLLI-SRRTDCDTAAAHAKGVLEAPNELVTDTMMPAEPRY 1287
              |..|:.::|::. .|.||.|            ..:|..:...|..|||
plant   581 ERRFYLYNELRVVFPQRHTDSD------------EGKLNVEYHYPENPRY 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9005NP_001369081.1 DUF4210 1074..1131 CDD:404751 23/84 (27%)
Chromosome_seg 1226..1290 CDD:404729 21/82 (26%)
AT5G41110NP_001332177.1 DUF4210 356..>403 CDD:372811 16/48 (33%)
Chromosome_seg 548..620 CDD:372787 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002608
OrthoInspector 1 1.000 - - oto4101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13199
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.